KEGG   Salmonella bongori NCTC 12419: SBG_1351Help
Entry
SBG_1351          CDS       T01579                                 

Definition
(GenBank) putative glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
sbg00220  Arginine biosynthesis
sbg00250  Alanine, aspartate and glutamate metabolism
sbg00471  D-Glutamine and D-glutamate metabolism
sbg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SBG_1351
   00220 Arginine biosynthesis
    SBG_1351
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    SBG_1351
Enzymes [BR:sbg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     SBG_1351
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: CCC30440
UniProt: A0A0K0HAD2
Position
1478383..1479309
Genome map
AA seq 308 aa AA seqDB search
MARTMDNAILETILQRVRPLIGQGKVADYIPALASVEGAKLGIAICTVDGQHYQAGDAHE
RFSIQSISKVLSLVVAMRHYQEEEIWQRVGKDPSGSPFNSLVQLEMEQGIPRNPFINAGA
LVVCDMLQGRLSAPRQRMLEIVRALCGVSDITYDSTVARSEFEHSARNAAIAWLMKSFGN
FHHDVPTVLQNYFHYCALKMSCMELARTFVFLANQGKAFHLDEPVVTPMQARQINALMAT
SGMYQNAGEFAWRVGLPAKSGVGGGIVAIVPHEMAIAVWSPELDPAGNSLAGIAALEQLT
QTLGRSVY
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
gtggccaggaccatggacaatgcaattttagagacgattttacagcgcgttcgccccctg
attggtcaggggaaagttgctgactatatcccggcattagcgtctgtcgagggggcaaag
ctgggaatagcgatttgtactgtggatgggcagcattaccaggcgggcgatgcgcacgag
cgcttttctattcagtctatatcgaaagtgctgagtctggtggtggcgatgcgtcattat
caggaagaggagatctggcagcgtgtcggaaaagatccttccggctcgccgttcaattcg
ctggttcagttagagatggaacaaggcattccgcgtaatccttttattaatgcgggtgcg
ctggtggtatgcgacatgttgcaaggacggcttagtgcgccgcgtcagcggatgcttgag
attgtgcgtgcgttatgcggcgtatcagatatcacatatgattctacggttgctcgctct
gagtttgagcattccgcccgtaatgccgctattgcctggctgatgaagtcatttggtaac
tttcatcatgatgtgcccaccgttctgcaaaattacttccactattgcgcgttaaaaatg
agttgtatggagctggcgagaacatttgtctttctggctaatcagggaaaggcatttcat
ctcgacgaaccggtagtaacgcccatgcaggccaggcaaattaacgccctgatggcgacc
agtggtatgtatcagaacgccggggaatttgcctggcgtgtggggttgccagccaagtct
ggggtgggaggcggtattgtcgccattgtgccgcatgaaatggcgattgccgtctggagt
ccggagctggatcctgcgggaaactctctggcaggtattgccgcgcttgaacaattaaca
caaacgttaggacgttcggtatactga

DBGET integrated database retrieval system