KEGG   Salmonella bongori NCTC 12419: SBG_1387Help
Entry
SBG_1387          CDS       T01579                                 

Gene name
adhP
Definition
alcohol dehydrogenase
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SBG_1387 (adhP)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBG_1387 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    SBG_1387 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    SBG_1387 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SBG_1387 (adhP)
   00626 Naphthalene degradation
    SBG_1387 (adhP)
Enzymes [BR:sbg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     SBG_1387 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1521787..1522797
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTQDHQVDVTEKTLRPLRHGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVAEVGPGVASLKPGDRASVAWFFEGCGHCEYCNTGNETLCRNVKNAGYTVDGGMAEE
CIVVADYAVKVPDGLDSAAASSITCAGVTTYKAVKVSHIKPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDGQLKLAEEMGADLTINSRTEDAAKMVQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPEAMNLDIPRLVLDGIQVVGSLVGTRQDLTEAFQFAAEG
KVVPKVALRPLEDINAIFKEMEQGQIRGRMVIDFRR
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctgctgttgtcacacaagatcatcaggttgatgttactgagaaaacgctgcgt
ccccttcgccacggtgaagccttgctgaaaatggagtgctgtggcgtatgccataccgat
ctccacgtaaaaaacggagatttcggtgacaaaactggtgtcattcttggacatgaaggt
attggcgtcgttgctgaggtcgggcccggcgtagcttcgctaaagccaggcgaccgtgcg
agcgttgcgtggttttttgaaggatgcgggcactgtgagtattgcaatacgggtaatgaa
actctgtgccgtaacgtaaaaaatgccggatacacggtggacggcggcatggccgaagag
tgtattgtggtcgcggattatgcggtgaaggtgccggatggtctggattctgcggcggca
agcagtattacctgcgcgggcgttactacctataaagcggtaaaagtttcacatattaaa
cctggccagtggatagccatttatggtctgggcggtcttggtaatctggcattgcaatac
gcgaaaaatgtctttaatgctaaagtgatcgccattgatgttaatgatggacagcttaaa
ctggccgaagaaatgggcgcggacctgaccattaattcacgtacagaagacgcagcgaaa
atggtgcaggaaaaaaccggcggcgcacatgcggctgtcgtcaccgcagtcgctaaggcg
gcgtttaattccgcagtagatgccgttcgcgccggaggccgcgtagtggcagtcggcctg
ccgccagaagccatgaaccttgatatccctcgtctggtactggatgggattcaggttgtc
ggttcgctggtaggtacacgtcaggatcttactgaagccttccagttcgcagcggaagga
aaagtcgtgccgaaagttgctttgcgtccgcttgaagatatcaacgctatttttaaagag
atggaacagggacaaatccgtggccgtatggtcatcgacttccgtcgttaa

DBGET integrated database retrieval system