KEGG   Salmonella bongori NCTC 12419: SBG_1547Help
Entry
SBG_1547          CDS       T01579                                 

Definition
sucrose phosphorylase (EC:2.4.1.7)
Orthology
K00690  
sucrose phosphorylase [EC:2.4.1.7]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SBG_1547
Enzymes [BR:sbg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.7  sucrose phosphorylase
     SBG_1547
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1694001..1695683)
Genome map
AA seq 560 aa AA seqDB search
MNQKIEKYLSKIYGNTFTPQHCKALNSRIEKSRLLISKKRKAHWDERDVVLITYADQFHS
DTSKPLPTFNQFHRRWLATIFSHLHLLPFYPWSSDDGFSVIDYHQVAPETGEWGDLNALS
QTNQLMFDFVCNHMSARSEWFDNYLQQTPGFENFFIAIDPLTDLSAVTRPRALPLLTPFT
LKDNSVRHLWTTFSEDQIDLNYRCPEVLLAMVDVLLTYIEKGADYIRLDAVGFMWKAPGT
SCIHLPQTHLLVKLFRAITDEVAPGVVIITETNVPHKDNIAYLGNGEDEAHMVYQFSLPP
LVLHAVHGQDVSALCSWAQSLQLPSENTTWFNFLASHDGIGLNPLRGLLPEEEILDLVEH
LQQEGALVNWKNNPDGSRSPYEINVTYLDALSHRESTDDQRLSRFILAHAILLSFPGVPA
IYIQSILGSRNDYDGVEKSGYNRAINRKKYLREKIEAELMDDSTLRYRVYYALSRLITIR
RNSKAFHPESTFSIKKISPCIMQIERIAKTGECVVALFNVSDNINSVNGEPFHGTDLISE
ANLSGEILMLRPWQVLWIKK
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
gtgaatcagaaaatcgagaaatacctgtcaaaaatctatggaaacacatttacgccacaa
cattgtaaggcgcttaactcacgcatcgaaaaatcgcgtttattaatttcaaaaaaacgt
aaagcacactgggatgaaagggatgttgtgcttattacttacgccgatcaatttcacagc
gacacatcaaaaccattgccgacatttaatcaatttcatcggcgatggctggcgactatt
ttttctcaccttcatcttttacctttttatccgtggtcttcggatgatggtttttcagtt
attgattatcatcaggttgcgcctgagacgggcgagtggggtgatctcaacgcgcttagc
cagactaaccaactgatgtttgactttgtttgtaatcatatgtcggccagaagtgaatgg
ttcgacaattatttacaacagacgccgggctttgaaaatttttttattgctatagaccca
ttaaccgaccttagcgcagtaacccggccacgtgccttgccattgctcacgccatttacc
ctgaaggataattctgttcgtcatctatggacgaccttcagtgaggaccagattgatctc
aattatcggtgcccggaagttttactggcgatggtcgatgtactactgacttatatagag
aagggagctgattatattcgtctggacgcggtgggatttatgtggaaagcaccaggaact
tcatgtatccatcttccccaaacgcatctgctggttaagctctttcgcgctattactgat
gaggtcgcgccaggggtggttattatcactgagaccaatgttccgcataaagataatatt
gcgtacctgggtaatggtgaggatgaggcgcatatggtctatcaattttcgctaccgcca
ctggtattacatgctgttcacggccaggatgtgtctgcgttgtgctcctgggcacaatcc
ctgcagcttccttcagaaaatacgacctggttcaattttctggcatctcatgacggcatt
gggcttaatccattacgcggtcttctaccggaagaagagatactggacctggtagagcat
ttacagcaagaaggcgcattagttaactggaaaaataacccggacggtagtcgaagtcct
tatgaaataaacgtgacatatctggatgcgcttagtcatcgtgaaagtactgatgaccag
cgtctttccaggtttattctggctcatgccattttactctcttttccaggcgtgccagcg
atatatatacaaagtattctgggctcccgtaatgattatgatggtgtggaaaagtcagga
tataaccgggcgattaacagaaaaaaatatcttcgagaaaaaattgaagccgaattaatg
gatgacagtacattaagatatcgtgtctattatgccttatccagacttatcacgattcgt
cgaaacagtaaagcatttcatccggaaagcacgttttctattaaaaaaatatcaccatgc
attatgcaaatcgagagaatagcaaagacaggggaatgcgtggtcgctttatttaacgta
agcgataatataaatagtgttaatggtgaaccatttcacggtactgatttaattagtgag
gcgaatctctctggcgagatattaatgctacgtccctggcaggttttgtggattaaaaaa
taa

DBGET integrated database retrieval system