KEGG   Salmonella bongori NCTC 12419: SBG_1588Help
Entry
SBG_1588          CDS       T01579                                 

Gene name
trpB
Definition
tryptophan synthase beta chain
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SBG_1588 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SBG_1588 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SBG_1588 (trpB)
Enzymes [BR:sbg01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SBG_1588 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1738016..1739209
Genome map
AA seq 397 aa AA seqDB search
MTTLLNPYFGEFGGMYVPQILMPALRQLEEAFVSAQKDPEFQAQFADLLKNYAGRPTALT
KCQNITAGTRTTLYLKREDLLHGGAHKTNQVLGQALLAKRMGKTEIIAETGAGQHGVASA
LASALLGLKCRIYMGAKDVERQSPNVFRMRLMGADVIPVHSGSSTLKDACNEALRDWSGS
YETAHYMLGTAAGPHPYPTIVREFQRMIGEETKAQILDKEGRLPDAVIACVGGGSNAIGM
FADFINDASVGLIGVEPGGHGIETGEHGAPLKHGRTGIYFGMKAPMMQTADGQIEESYSI
SAGLDFPSVGPQHAHLNSIGRADYVSITDDEALEAFKTLCRKEGIIPALESSHALAHALK
MMREHPEKEQLLVVNLSGRGDKDIFTVHDILKARGEI
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgacaacacttctcaatccctattttggtgaattcggcggcatgtacgtgccgcagatc
ctgatgcccgcgctacgccagcttgaagaggccttcgtcagcgcgcaaaaagatcctgag
tttcaggcgcaattcgccgatctactgaaaaactatgcgggacgccctaccgctctgacc
aaatgccagaacatcaccgccggtacgcgtaccacgttatatctgaaacgcgaagattta
ctgcacggcggcgcgcataaaactaaccaggttctgggtcaggcactgttggctaagcga
atgggtaaaaccgaaattattgcggaaactggcgctggccagcacggcgtagcctccgcg
ctcgccagcgcgctgctggggctgaaatgccgtatctatatgggcgccaaagacgttgag
cgccagtcgccaaacgtcttccgtatgcgtctgatgggtgcagatgtgatccccgttcat
agcggttcatccacactcaaagacgcctgtaacgaggcgctacgcgactggtccggcagc
tatgaaaccgcgcactatatgctcggtacggcagcaggcccgcatccctatccgactatt
gttcgcgagtttcagcgcatgatcggcgaagagacgaaagcgcaaattctcgacaaagag
gggcgtctgcctgatgccgttatcgcctgcgtcggcggtgggtcaaacgctatcgggatg
tttgccgattttattaatgacgccagcgtcgggcttattggtgttgaacctggcggtcac
ggtattgaaacaggagagcatggcgccccgcttaaacatggtcgtaccgggatctatttc
ggcatgaaagcgccaatgatgcaaacggctgacggacaaattgaagaatcttattctatt
tccgccgggctggattttccgtccgttgggccgcaacatgcgcacctgaacagcattgga
cgcgcggattacgtctccattactgatgacgaagcgctggaagccttcaagacactgtgc
cgcaaggaagggattatcccggcgctggaatcctcccacgctctggcgcacgcgttgaaa
atgatgcgcgaacacccggaaaaagagcaactgctggtggtcaatctctctggccgcggc
gataaagacatctttaccgtacatgatattttgaaagcgcgaggggaaatctga

DBGET integrated database retrieval system