KEGG   Salmonella bongori NCTC 12419: SBG_1589Help
Entry
SBG_1589          CDS       T01579                                 

Gene name
trpA
Definition
tryptophan synthase alpha chain
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sbg01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:sbg00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:sbg00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1739209..1740015
Genome map
AA seq 268 aa AA seqDB search
MGRYENLFAQLNERREGAFVPFVTLGDPGIEQSLHIIDTLIEAGADALELGVPFSDPLAD
GPTIQNANLRAFAAGITPAQCFEMLALIREKYPSIPIGLLMYANLVFNDGIDEFYARCKK
VGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRA
GVTGAENRGGLPLHHLVRKLKEYNAAPALQGFGISSPEQVTAAVHAGAAGAISGSAIVNI
IEKNHCHPDQMLAELRAFVCAMKAASRA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgggacgttatgaaaatttatttgcgcagctcaacgaacgccgggaaggcgcctttgtc
cccttcgtcaccctgggcgacccgggcatagaacaatcgctgcacattattgatacgttg
attgaagccggcgccgatgctctggagttaggcgttcccttctccgatccgcttgctgac
ggccctaccatccagaatgcgaacttacgcgccttcgccgctgggatcacgcctgcccag
tgtttcgaaatgctggcgctgatccgtgaaaaatacccgtctattccgattggcctgctg
atgtatgccaacctggtatttaatgacggcattgatgaattctatgcccgttgtaaaaaa
gtcggcgtggattccgtgctggtcgcggatgtcccggttgaagagtctgcccccttccgt
caggcggcgctacgacataatatcgcgccgattttcatctgcccgccaaatgcggatgac
gatcttctgcgccaggtcgcttcttatggccgtggctatacttacctgctttcccgggcg
ggcgttaccggtgcggaaaatcgtggcggattgccactacaccatctggtcaggaaactt
aaagaatataatgccgcgcctgctttgcaggggtttggtatctcctcgccggaacaagtg
accgctgccgttcatgctggtgcggctggcgcgatctccggttcggcgattgtcaacatt
attgagaaaaaccactgtcatccagaccagatgctggcggaactcagggcttttgtctgt
gcgatgaaagccgccagccgcgcataa

DBGET integrated database retrieval system