KEGG   Salmonella bongori NCTC 12419: SBG_1639Help
Entry
SBG_1639          CDS       T01579                                 

Gene name
ipk
Definition
(GenBank) isopentenyl monophosphate kinase
  KO
K00919  4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
sbg00900  Terpenoid backbone biosynthesis
sbg01100  Metabolic pathways
sbg01110  Biosynthesis of secondary metabolites
sbg01130  Biosynthesis of antibiotics
Module
sbg_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    SBG_1639 (ipk)
Enzymes [BR:sbg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     SBG_1639 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GHMP_kinases_N GHMP_kinases_C
Motif
Other DBs
NCBI-ProteinID: CCC30715
UniProt: A0A0K0HAT7
Position
1790720..1791571
Genome map
AA seq 283 aa AA seqDB search
MKTHWPSPAKLNLFLYITGQRADGYHTLQTLFQFLDYGDTLHIEPRRDGEIHLLTPVNGV
ENEDNLIIRAARLLVKTASESGRLSAGSGADISIEKRLPMGGGLGGGSSNAATVLVALNH
LWQCGLSIDELATLGLTLGADVPVFIRGHAAFAEGVGEILTPVSPPEKWYLVAHPGVSIP
TPVIFKDPQLPRNTPKRSIDTLLKCEFSNDCEVIARKRFREVDAALSWLLEYAPSRLTGT
GACVFAEFDTESHARQVLEQAPEWLNGFVAKGVNLSPLYKELL
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atgaagacccactggccctccccggcaaaactcaatctgtttttatatatcaccgggcag
cgtgcggacggctaccacacgctgcaaacgttgtttcagttccttgattacggcgacact
ctccatatcgaaccgcgtcgcgacggggaaatccatttattaaccccggtaaatggtgtt
gaaaatgaagacaacctgatcatccgcgccgcgcggctattggtgaaaaccgcctcggaa
agtggacgtctttccgccggaagcggcgcggatatcagcattgagaagcgtttgccgatg
ggcggcggtctgggcggcggttcgtctaacgccgcgaccgttctggtggcgctcaatcac
ctttggcaatgcgggctttccattgatgaactggcaacacttggtctgacgctcggcgca
gatgtcccggtctttattcgtggtcacgccgcttttgctgaaggcgtgggcgaaatatta
acgcccgtgagcccgccggaaaaatggtatctggtggcacatccaggcgtcagtattccg
acgccggttatctttaaagatcctcaattgccgcgcaatacgccaaaaaggtcaatagac
acgttactaaaatgtgaattcagcaatgattgcgaggttatcgcaagaaaacgttttcgc
gaggttgatgcggcgctttcctggctgttagaatacgcgccgtcgcgcctgactgggaca
ggggcctgtgtctttgctgaatttgatacagagtctcatgctcgccaggtgcttgagcaa
gccccggaatggctcaatggctttgtggcgaaaggcgtcaacctttcccccttgtacaaa
gagttactctaa

DBGET integrated database retrieval system