KEGG   Salmonella bongori NCTC 12419: SBG_1732Help
Entry
SBG_1732          CDS       T01579                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:sbg03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1893094..1893705)
Genome map
AA seq 203 aa AA seqDB search
MIGRLRGIILEKQPPLVLLEAGGVGYEVHMPMTCFYELPEAGQETIVFTHFVVREDAQLL
YGFNNKQERTLFKELIKTNGVGPKLALAILSGMSAQQFVNAVEREDPAALVKLPGIGKKT
AERLIVEMKDRFKGLHGDLFTPATDLVLASPASPVTEDAEQEAVAALVALGYKPQEASRM
ISKIARPDASSETLIRDALRAAL
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
gtgataggcagactcagaggcattattctcgaaaaacaacctccgctggtacttctggag
gcgggcggcgtcggctatgaagtgcatatgccgatgacctgcttttatgagttgccggaa
gcggggcaggaaaccatcgtctttacccattttgtggtgcgtgaagatgctcagttgctt
tatggtttcaacaacaaacaggaacgtaccctgtttaaagaattgattaagacgaacggc
gtcggaccgaagctggcattagccatcctttccggcatgtcggcacagcagttcgttaac
gcggttgagcgcgaagatcctgcggcgctggtgaaactgccaggtattggcaagaaaacc
gctgagcggttgattgtcgaaatgaaagaccgctttaagggactgcatggcgatctcttt
acgccagcgaccgatctggtactggcatcgccagccagtccggtaacggaagacgctgag
caggaagcggtagctgcgctggtggcgctgggttataaaccacaagaagccagccggatg
ataagtaaaatcgcccgtccggacgccagcagtgaaacactgattcgcgacgcgttacgc
gctgcgttatga

DBGET integrated database retrieval system