KEGG   Salmonella bongori NCTC 12419: SBG_1753Help
Entry
SBG_1753          CDS       T01579                                 

Gene name
cheB
Definition
protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:sbg02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:sbg02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1914894..1915943)
Genome map
AA seq 349 aa AA seqDB search
MSKIRVLSVDDSALMRQIMTEIINSHSDMEMVATAPDPLVARDLIKKFNPDVLTLDVEMP
RMDGLDFLEKLMRLRPMPVVMVSSLTGKGSEVTLRALELGAIDFVTKPQLGIREGMLAYS
EMIAEKVRTAARARIAVHKPIAAPATLKAGPLLSSEKLIAIGASTGGTEAIRHVLQPLPL
SSPAVIITQHMPPGFTRSFAERLNKLCQISVKEAEDGERVLPGHAYIAPGDKHMELARSG
ANYQIKIHDGPPVNRHRPSVDVLFHSVAKHAGRNAVGVILTGMGNDGAAGMLAMYQAGAW
TIAQNEASCVVFGMPREAINMGGVSEVVDLSQVSQQMLAKISAGQAIRI
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatcagggtattgtcggttgatgattctgcgctgatgcgccaaatcatgact
gaaattattaatagccatagtgatatggaaatggtggcaacagcgccagacccgctagtc
gccagagacctcatcaaaaaatttaatccggacgtattgacgctggacgttgagatgccg
cgtatggacggcctcgatttccttgaaaaactgatgcgcttgcgcccgatgccggtggtg
atggtctcctcgctgaccggtaaaggatctgaagttacgctgcgggcgctggagctggga
gccatcgattttgtcaccaaaccacagctcggcattcgtgagggtatgttggcatatagc
gaaatgatcgccgagaaggtacgaaccgccgcgcgggcccgtattgccgtgcataaaccg
atagcggccccggcaaccttaaaggctgggccgctgctcagttcggaaaaactgatcgct
atcggcgcttcgacgggcggtactgaagctattcgccatgtgctgcaaccactgccgctt
tccagtccggcagtcatcattacgcagcatatgccgcctggctttacccgttcgtttgct
gaacgtcttaataaactctgtcaaatcagcgtcaaggaggccgaagacggcgaacgcgta
ttgccaggtcatgcctatattgcgcccggcgataaacacatggagttggcgcgcagtggg
gcgaattatcaaatcaaaattcatgatggcccgccggtaaaccggcatcggccttccgtg
gatgtgctgtttcactcggtggcgaaacatgcggggcgcaacgctgtaggcgtcattctt
acggggatgggcaacgatggcgccgccggaatgttagcgatgtaccaggcaggcgcctgg
accattgcgcaaaacgaagcaagttgtgtggtgttcggcatgccgcgcgaggccatcaat
atgggtggcgtaagcgaagtggtcgatcttagccaggtaagccagcagatgctggcgaaa
atcagtgccggacaggcgatacgtatttga

DBGET integrated database retrieval system