KEGG   Salmonella bongori NCTC 12419: SBG_1783Help
Entry
SBG_1783          CDS       T01579                                 

Definition
deaminase
Orthology
K05396  
D-cysteine desulfhydrase [EC:4.4.1.15]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    SBG_1783
Enzymes [BR:sbg01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.15  D-cysteine desulfhydrase
     SBG_1783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1944273..1945259)
Genome map
AA seq 328 aa AA seqDB search
MPLHHLTRFPRLEFIGAPTPLEYLPRLSDYLGREIYIKRDDVTPIAMGGNKLRKLEFLVA
DALREGADTLVTAGAIQSNHVRQTAAVAAKLGLHCVALLENPVGTTAENYLTNGNRLLLD
LFNTQVEMCDALTDPDAQLQSLATRIEAQGFRPYVIPVGGSSALGAMGYVESALEIAQQC
EEVVGLSSVVVASGSAGTHAGLAVGLEHLMPDVELIGVTVSRSVAEQKPKVIALQQAIAG
KLALTATADIHLWDDYFAPGYGIPNDAGMEAVKLLARLEGLLLDPVYTGKAMAGLIDGIS
QRRFKDEGPILFIHTGGAPALFAYHPHV
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgccactacatcacttaacgcgcttcccgcgtctggaatttatcggcgcgccgaccccg
ctcgaatacctgccgcgactgtctgattatcttggccgtgaaatttacattaagcgcgat
gacgttacgcccattgcgatgggcggcaataaattacgcaagctggagtttctggtggcc
gacgcgctgcgggaaggggcggatacgctggtaacggcaggggcgattcagtcgaatcat
gtccgccagacggcagctgtcgcggccaaactgggactgcattgcgtcgccttgctggaa
aatcctgtcggcacgaccgcagaaaactacctgacaaacggtaatcgcctgttactggat
ttatttaatacgcaagttgagatgtgtgacgcgctgaccgatccggacgcacagttgcaa
tcgttggcgacgcgtattgaagcacaggggttcagaccgtatgtgattcctgttggcggc
tccagtgcgctgggcgccatgggttacgttgagagcgcgctggaaattgcgcagcagtgt
gaagaggtcgtggggctctcttcggtggtggtggcctctggcagcgccgggacgcacgcc
gggttagccgttgggctggaacatctgatgccagatgttgaactgattggcgtcaccgtt
tcacgttctgtcgccgagcagaaacccaaagtgattgctttgcagcaggcgattgccggt
aaactggcgctgaccgcaacggcggatattcatttatgggatgactattttgcgccgggt
tacggcataccaaacgatgcgggaatggaggccgtgaaactgttggcgcgtctggagggg
ctattgctggatccggtttataccggcaaagcgatggcgggcctgatcgatggcatcagc
cagcgacgttttaaagacgaagggccgattctctttattcacaccggtggggcgcctgcg
ctgtttgcctaccatcctcatgtataa

DBGET integrated database retrieval system