KEGG   Salmonella bongori NCTC 12419: SBG_1899Help
Entry
SBG_1899          CDS       T01579                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
sbg00340  Histidine metabolism
sbg01100  Metabolic pathways
sbg01110  Biosynthesis of secondary metabolites
sbg01230  Biosynthesis of amino acids
Module
sbg_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    SBG_1899 (hisD)
Enzymes [BR:sbg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     SBG_1899 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: CCC30963
UniProt: A0A0K0HBI5
Position
2059968..2061272
Genome map
AA seq 434 aa AA seqDB search
MSFNTLIDWNSCNADQQRELLMRPAISASDSITRTVCEILDNVKARGDEALREYSAKFDK
TTVKALKVSAEEIAAASARLGDDLKSAMAVAVKNIETFHSAQMLPSVDVETQPGVRCQQV
TRPIASVGLYIPGGSAPLFSTVLMLATPARIAGCQKVVLCSPPPIADEILYAAQLCGIEE
IFNVGGAQAIAALAFGSESVPKVDKIFGPGNAFVTEAKRQVSQRLDGAAIDMPAGPSEVL
VIADSGATPDFVASDLLSQAEHGPDSQVILLTPDVDIARKVAEAVERQLAELPRADTARQ
ALSASRLIVTKDLAQCVAISNQYGPEHLIIQTRNARDLVDAITSAGSVFLGDWSPESAGD
YASGTNHVLPTYGYTATCSSLGLADFQKRMTVQELSKAGFSALASTIETLAAAERLTAHK
NAVTLRVKALKEQA
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgagcttcaataccctgattgactggaacagctgtaacgcagaccagcagcgcgagcta
ctgatgcgcccggctatctcggcatccgacagcatcacccgcacggtgtgcgagattctg
gataacgttaaagcgcgcggtgacgaagccctgcgtgaatacagcgcgaaatttgataag
accaccgttaaggcattaaaagtcagtgccgaagagattgccgccgccagcgcacggctg
ggcgacgatctcaaaagcgctatggcagtggcggtaaaaaacatcgaaacgttccactca
gcgcaaatgctgccgtcagtcgatgtggaaacccagcctggcgtgcgttgccagcaggtt
acgcgtcctatcgcctctgtcgggctgtatattcccggcggttcggccccgctcttttca
accgtccttatgctggcaacgccggcgcgcattgccggctgtcagaaagtggttctgtgc
tcaccacctcctatcgctgacgaaatcctttatgcggcacagctgtgtggcatagaagaa
atctttaatgtcggcggcgcgcaggcgattgccgctctggccttcggcagcgaatcggtt
ccgaaagtcgataaaatttttggccctggcaacgcctttgtgaccgaagccaaacgtcag
gtcagccagcgtctcgacggcgcagctatcgatatgcctgccgggccatctgaagtgctg
gtgatcgccgacagcggcgcaacgccggattttgtcgcatctgacctgctctcccaggca
gaacacggtccggattcccaggtgattttgctgacgccggatgttgacattgcccgcaag
gtggcggaggcggtagaacgtcaactggcagaactgccgcgcgcggacaccgcccggcag
gccctgagcgccagtcgtctgattgtgaccaaagatttagcgcagtgcgtcgccatctct
aatcagtatgggccggaacacttaatcatccagacgcgaaatgcgcgcgatttggtggat
gcgattaccagcgcaggctcggtatttctcggcgactggtcgccggaatccgccggtgat
tacgcttccggaaccaaccatgttttaccgacctatggctatactgctacctgctccagc
ctggggttagcggacttccagaaacggatgaccgttcaggaactgtcgaaagcgggcttt
tccgctctggcatcaaccattgaaacgttggcggcggcagaacgtctgaccgcccataaa
aatgccgttaccctgcgcgtaaaggccctcaaggagcaagcatga

DBGET integrated database retrieval system