KEGG   Salmonella bongori NCTC 12419: SBG_1916Help
Entry
SBG_1916          CDS       T01579                                 

Gene name
galF
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SBG_1916 (galF)
   00052 Galactose metabolism
    SBG_1916 (galF)
   00500 Starch and sucrose metabolism
    SBG_1916 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    SBG_1916 (galF)
Enzymes [BR:sbg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SBG_1916 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2077970..2078863)
Genome map
AA seq 297 aa AA seqDB search
MTNLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVTHASK
NAVENHFDTSYELESLLEQRVKRQLLAEVQSICPPGVTIMNVRQAQPLGLGHSILCARPV
VGDNPFVVVLPDIIIDDATADPLRYNLAAMVARFNETGRSQVLAKRMKGDLSEYSVIQTK
EPLDNEGKVSRIVEFIEKPDQPQTLDSDLMAVGRYVLSDDIWAELERTEPGAWGRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKMGYMQAFVKYGLRNLKEGAKFRKSIEQLLTE
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgactaatttgaaagcagttataccggtagcggggttgggtatgcacatgttgcctgcc
accaaggcaatcccaaaagagatgctaccgatcgtcgacaaaccgatgattcagtacatt
gttgatgagattgtggctgcagggatcaaagaaatcgttttggtgactcacgcatctaaa
aatgccgttgagaaccacttcgatacctcttatgaacttgaatcgcttcttgagcagcgc
gttaagcgccagcttctggcggaagtgcaatctatctgcccgccgggcgtgactatcatg
aacgttcgtcaggcgcagccattggggcttgggcactctattttgtgcgcgcgtccggtg
gtgggtgataacccttttgtcgtggtccttcctgatatcattattgatgatgctactgcc
gatccgctgcgctataacctcgcggcgatggtagcgcgtttcaacgaaacgggccgcagc
caggtgctggcgaagcgcatgaaaggcgatttatcggagtattctgttatccagaccaaa
gagccgctggataatgaaggcaaagtgagccggattgtcgaatttatcgaaaaaccggat
cagccgcagactttagattccgatctgatggcggtaggtcgttatgtgctttcagatgac
atctgggcagaactggaaagaaccgaacccggcgcctgggggcgtatccagctcaccgat
gccattgctgagctggcgaaaaaacagtcggttgacgcgatgctgatgacgggcgacagc
tatgactgcggtaaaaaaatgggctatatgcaggcatttgtgaagtatgggctgcgtaac
ctgaaagaaggggcgaagttccgtaagagcatagagcaattgcttactgagtaa

DBGET integrated database retrieval system