KEGG   Salmonella bongori NCTC 12419: SBG_2005Help
Entry
SBG_2005          CDS       T01579                                 

Gene name
folE
Definition
(GenBank) GTP cyclohydrolase I
  KO
K01495  GTP cyclohydrolase IA [EC:3.5.4.16]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
sbg00790  Folate biosynthesis
sbg01100  Metabolic pathways
Module
sbg_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SBG_2005 (folE)
Enzymes [BR:sbg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     SBG_2005 (folE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_cyclohydroI QueF
Motif
Other DBs
NCBI-ProteinID: CCC31067
UniProt: A0A0K0HC34
Position
complement(2182675..2183343)
Genome map
AA seq 222 aa AA seqDB search
MPSLSKEAALVHDALVARGLETPLRPAVDELDNETRKRLIAGHMTEIMQLLNLDLSDDSL
METPHRIAKMYVDEIFAGLDYTNFPKITLIENKMKVDEMVTVRDITLTSTCEHHFVTIDG
KATVAYIPKDAVIGLSKINRIVQFFAQRPQVQERLTQQILTALQTLLGTNNVAVSIDAVH
YCVKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHS
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgccatcactcagtaaagaagcggccctggttcatgacgcgctggttgcccgggggctg
gaaacgccgctgcgcccggctgtggatgaattagataatgaaacgcgaaaacgcctcatc
gcagggcatatgactgagatcatgcagttgctgaatctcgatttgagcgatgacagtttg
atggaaacgccgcatcgtatcgcgaagatgtatgttgatgagattttcgccggtctcgac
tataccaatttccccaaaattaccctcattgaaaataaaatgaaggtcgacgaaatggtc
accgttcgcgatatcacgctgaccagcacctgtgagcaccactttgtgaccattgatggt
aaagctaccgtcgcctatatccctaaagacgctgtgattggtctgtcaaaaattaaccgt
atcgtgcaattcttcgcccagcgcccgcaggtgcaggagcgtctgactcagcaaattttg
acggcgctgcaaacgttgcttggcaccaataatgtggcagtttcgattgatgcggtgcat
tactgtgtgaaagcgcgtggtatacgcgatgcgaccagcgccacgacgacgacctcgctg
ggcggcttgtttaaatccagccagaacacgcgtcaggagttcctgcgcgctgttcgccat
catagctga

DBGET integrated database retrieval system