KEGG   Salmonella bongori NCTC 12419: SBG_2263Help
Entry
SBG_2263          CDS       T01579                                 

Gene name
dapE
Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
sbg00300  Lysine biosynthesis
sbg01100  Metabolic pathways
sbg01120  Microbial metabolism in diverse environments
sbg01230  Biosynthesis of amino acids
Module
sbg_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    SBG_2263 (dapE)
Enzymes [BR:sbg01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     SBG_2263 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: CCC31321
UniProt: A0A0K0HD40
Position
2465547..2466674
Genome map
AA seq 375 aa AA seqDB search
MSCPVIELTQQLIRRPSLSPDDAGCQALMIDRLRKIGFTIEHMDFGDTQNFWAWRGRGET
LAFAGHTDVVPAGDVDRWINPPFEPTIRDGMLFGRGAADMKGSLAAMVVAAERFVAQHPH
HRGRLAFLITSDEEASAKNGTVKVVEALMARNERLDYCLVGEPSSTEIVGDVVKNGRRGS
LTCNLTIHGVQGHVAYPHLADNPVHRAAPFLHELVAIEWDRGNDFFPATSMQVANIQAGT
GSNNVIPGELFVQFNFRFSTELTDQMIKDQVHALLEKYQLRYTVDWWLSGQPFLTARGKL
VDAVVNAIEHYNEIKPQLLTTGGTSDGRFIARMGAQVVELGPVNATIHKINECVNAADLQ
LLARMYQRIMEQLVA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgcccggttattgagctgacacagcaacttattcgtcgcccctccctgagtccg
gatgacgcaggctgccaggcattaatgattgatcgcctgcgtaaaattggttttaccatt
gagcacatggattttggcgacacgcaaaacttttgggcatggcgtggacgtggtgaaaca
ctggcattcgccgggcatactgatgtcgtgccagcaggcgatgtcgatcgctggatcaac
ccaccgtttgagcctacgattcgcgatggaatgctgtttggtcgcggcgcggcggatatg
aaaggttcactggcggccatggtggtggcagctgagcgttttgtcgcgcagcatcctcat
caccgcggtcgcctggcatttttgattacttctgatgaagaagccagcgcgaaaaatggc
actgtaaaggtggttgaggcgctgatggcccgtaacgagcggctggattactgtctggtt
ggcgaaccttccagtactgaaattgtgggcgatgtcgtcaaaaatgggcgtcgtggctca
cttacctgcaacctcactattcatggcgttcagggacacgtcgcgtatccgcatctggcg
gacaaccccgttcatcgcgccgcgccttttctccatgaactggtcgccattgaatgggat
cgcggcaatgactttttcccggccaccagtatgcaggtagccaatatccaggcaggcacc
ggcagcaataacgtcattcccggtgaactgttcgtgcagtttaactttcgtttcagcacg
gaactgaccgatcaaatgatcaaagatcaggtccatgcgctgcttgagaagtatcagcta
cgctataccgtagactggtggctttccggtcagccgttcctgaccgcgcgcggcaagctg
gtggacgcggtggtgaatgctattgagcactataatgaaattaaaccgcaattactgacg
acgggcggtacgtctgacggacgttttatcgctcgtatgggagcacaggtggtagaactg
gggccggtaaacgccacgattcataaaattaatgaatgtgtgaatgccgccgatctccag
ctactggcccgtatgtatcaacgtattatggaacaactcgtcgcctga

DBGET integrated database retrieval system