KEGG   Salmonella bongori NCTC 12419: SBG_2376Help
Entry
SBG_2376          CDS       T01579                                 

Gene name
sfhB
Definition
ftsH suppressor protein SfhB (EC:4.2.1.70)
Orthology
K06180  
23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
sbg  Salmonella bongori NCTC 12419
Brite
Enzymes [BR:sbg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     SBG_2376 (sfhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2609816..2610796)
Genome map
AA seq 326 aa AA seqDB search
MAQRVQLTATVSENQLGQRLDQALAEMFPDYSRSRIKEWILNQRVLVNGQLCDKPKEKML
GGELVAIDAEIDEESRFEPQDIPLDIVYEDDDIIVINKPRDLVVHPGAGNPDGTVLNALL
HYYPPIADVPRAGIVHRLDKDTTGLMVVAKTVPAQTRLVESLQLREITREYEAVAIGHMT
AGGTVNEPISRHPTKRTHMSVHPMGKPAVTHYRIMEHFRVHTRLRLRLETGRTHQIRVHM
AHITHPLVGDPVYGGRPRPPKGASEEFISTLRKFDRQALHATMLRLYHPVSGIEMEWHAP
IPQDMVELIDAMRADFDEHKDNVDWL
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atggcacaacgagtacaactcaccgcaacggtctccgaaaaccaactcggtcaacgctta
gatcaggctttggccgaaatgttcccggattattcacgttcacgtataaaagaatggatt
ttgaaccagcgcgtgctggttaatggtcagctttgcgataaaccaaaagaaaaaatgtta
ggcggcgagctggtggccatcgatgcggagatcgacgaagagagtcgcttcgagccccag
gatatcccgctggacatcgtttatgaagatgacgatatcattgttatcaacaaaccccgc
gatctggtcgtacacccaggtgctggtaacccggacgggacggtattgaacgcgttgctg
cactattatccgccgattgctgatgtgccccgtgcgggtattgtgcatcgtctggataag
gacacgacagggctgatggtggtggcgaaaacggttccggcgcaaacacgtctggtggag
tctttacagctgcgcgagattactcgcgaatatgaagcggtcgcgattggccatatgacg
gcgggaggaacagtgaatgaacctatcagtcgtcacccgaccaaacgaacccatatgtcg
gtacacccgatgggcaagccggcggtgacccattaccgtattatggagcattttcgtgtg
cacacgcgtcttagattgcgtctggaaactggccgcacgcaccagatccgcgtgcatatg
gcgcacatcacgcatccgctggtcggagacccggtatatggtggtcgtccacgcccgcca
aaaggcgcatcggaagaatttatctctacgctgcgtaagttcgaccgtcaggcgctccat
gcaacgatgcttcgcctttaccaccctgtatcaggtatcgaaatggaatggcacgcgccg
attccccaggatatggtggaacttatcgacgcgatgcgcgctgatttcgacgaacataaa
gataatgtggattggttatga

DBGET integrated database retrieval system