KEGG   Salmonella bongori NCTC 12419: SBG_2599Help
Entry
SBG_2599          CDS       T01579                                 

Gene name
recD
Definition
exonuclease V alpha-subunit
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    SBG_2599 (recD)
Enzymes [BR:sbg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     SBG_2599 (recD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2848979..2850814)
Genome map
AA seq 611 aa AA seqDB search
MTIQERLLEAVRQKLLRPIDAQFALTVAGYDDPAVTLAAALLSRDAGDGHVCLPLSRLTL
TGEAHPLLVSWISETDTPIDWKKRLLASAAVSGGDSPAPLILCGDRLYLNRMWCNERTVA
RFFNEVNQDVEVDEAQLARILDILFPPTDEVNWQKVAAAVALTRRISVISGGPGTGKTTT
VAKLLAALIQMADGERCRIRLAAPTGKAAARLTESLGAALRQLPLTDAQKKRIPEDASTL
HRLLGAQPGSQRLRHHAGNPLHLDVLVVDEASMIDLPMMSRLIDALPPHGRVIFLGDRDQ
LASVEAGAVLGDICAYVNAGFTAERARQLSRLTGSTIPAGTGTQAASLRDSLCLLQKSYR
FGSDSGIGKLAAAINCGDRSAIQAIFQQGFSDIEKRTLQSSDDYAGMLDEALAGYGRYLR
LLHEKAAPEALLQAFSDYQLLCALREGPFGVSGLNDRIEQAMVQQRKIQRHPHSRWYEGR
PVMIARNDSALGLFNGDIGIALDRGQGLRVWFAMPDGTIKSVQPSRLPEHETTWAMTVHK
SQGSEFEHAALILPSQRSPVVTRELVYTAVTRARRRLSLYAEERVLAGAIVTRTERRSGL
SALFDEVSRIE
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
atgacaatccaggagcggttactggaagccgtcagacaaaaattattacggcccattgat
gcccagtttgctttgaccgtcgccggttatgatgatcccgccgtgacgctggcggcagcg
ttgctaagccgtgatgcaggagacggccacgtctgtctgccgctgtcgcgtctgacgtta
acgggggaggcgcatcctttactggtttcgtggataagcgaaacggatacgccaatcgac
tggaaaaaacgtttgctggcgtctgcggcggttagcggtggcgatagccccgcgccgtta
attctgtgcggggatcgtctctatttgaatcgcatgtggtgcaatgagcgtacggtcgcg
cgcttttttaacgaggttaaccaggacgtcgaggttgacgaagcgcaacttgctcgtatt
ctggatatacttttcccgccgacggatgaggtaaactggcaaaaagtggccgccgccgtg
gcactcactcgccgtatttctgtgatttccggcggccctggcaccggtaaaaccacgacc
gtcgcgaagctgctggcggcattaattcaaatggcggatggcgaacgttgccgtatccgg
ctggcggcgccgacgggaaaggcggccgcacgcctgacggagtcgcttggcgcggcgttg
cgccagcttccgctgaccgatgcgcagaaaaaacggataccggaggacgccagtacgctg
caccgcctattaggcgcacagcccggcagccagcgattacgacaccacgcgggtaatcca
ttgcatctggatgtgctggtggtcgatgaagcgtcaatgattgatttaccgatgatgtcg
cgtttgattgacgcgctgccgccacatggtcgggttattttccttggcgatcgcgatcag
ttggcatccgttgaggcgggcgcagtattgggcgatatttgcgcctatgttaatgctggt
ttcacggcggagcgtgcccggcaattgagccgcctgacgggaagtacaattccggccggt
accgggacacaagccgcgtctttgcgcgatagcctctgtttactgcaaaagagctaccgt
tttggcagcgattccggtatcgggaaattggctgcggccattaactgcggtgacagatcg
gcaatccaggctatttttcagcaggggtttagcgatattgaaaagcgcacattgcaaagt
agcgacgattatgcagggatgctggatgaagcgctggcggggtatggtcgctacttgcgg
ttgctgcatgagaaagcggcgccagaggcgctccttcaggcattcagtgattatcaactg
ctttgcgcgttgcgcgaaggcccgtttggtgtaagtgggttgaatgaccgtattgagcag
gcaatggtccagcagcgtaaaattcaacggcatcctcattcccgctggtatgaggggcgg
ccagtgatgattgcgcgcaatgatagcgcgttggggttatttaacggcgatattggcatt
gcgctcgatcgcggacaggggctgcgcgtttggtttgcgatgccggacggcacgatcaag
tccgttcagcccagccgcttgccggagcacgaaaccacctgggcgatgacggtacataaa
tcacaggggtcggaatttgagcacgccgcgctgattctacccagccagcgttcaccggta
gttacgcgagaattagtgtataccgccgttacgcgcgcgcggcgacggttatcactgtac
gctgaggaaagggtactggcaggcgcgattgtgacgcgcacggaacggcgcagcggatta
tcggccttattcgacgaagtcagtcgcatcgaataa

DBGET integrated database retrieval system