KEGG   Salmonella bongori NCTC 12419: SBG_3132Help
Entry
SBG_3132          CDS       T01579                                 

Gene name
glgB
Definition
(GenBank) 1,4-alpha-glucan branching enzyme
  KO
K00700  1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
sbg00500  Starch and sucrose metabolism
sbg01100  Metabolic pathways
sbg01110  Biosynthesis of secondary metabolites
Module
sbg_M00565  Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SBG_3132 (glgB)
Enzymes [BR:sbg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SBG_3132 (glgB)
Exosome [BR:sbg04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SBG_3132 (glgB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CBM_48 Alpha-amylase_C Alpha-amylase Glyco_hydro_70 AMPK1_CBM
Motif
Other DBs
NCBI-ProteinID: CCC32185
UniProt: A0A0K0HF08
Position
complement(3423993..3426179)
Genome map
AA seq 728 aa AA seqDB search
MSSRIDRDVINALIAGHFADPFSVLGMHQTQAGLEVRALLPDATDVWVIETKTGRKVGKL
ECLDARGFFCGVLPRRKNFFRYQLAVVWHGQQNLIDDPYRFGPLIQEMDAWLLSEGTHLR
PYETLGAHADTMDGVTGTRFSVWAPNARRVSVVGQFNYWDGRRHPMRLRKESGIWELFIP
GAHNGQLYKFELLDANGNLRIKADPYAFEAQMRPETASMICGLPEKVTQSEERQKANRFD
APISIYEVHLGSWRRHTDNNFWLSYRELADQLVPYAKWMGFTHLELLPVNEHPFDGSWGY
QPTGLYAPTRRFGTRDDFRYFINAAHAAGLNVILDWVPGHFPSDEFSLAEFDGTHLYEHS
DPREGYHQDWNTLIYNYGRREVSNYLVGNALYWIERFGIDALRVDAVASMIYRDYSRKEG
EWIPNEFGGRENLEAIEFLRNTNRIIGEQVPGAVSMAEESTDFAGVTRPPEMGGLGFWYK
WNLGWMHDTLDYMKLDPVYRQYHHDKLTFGMVYNHTENFVLPLSHDEVVHGKKSILDRMP
GDAWQKFANLRAYYGWMWAFPGKKLLFMGNEFAQGREWNHDVSLDWHLLEGGDNWHHGVQ
RLVRDLNHTYRHHKALHELDFDAYGFEWLVVDDHERSVFIFVRRDKAGNEIIIASNFTPV
PRHDYRFGINQPGRWREILNTDSMHYHGSNAGNGGVVHSDEIESHGRPHSLSLTLPPLAT
IWLMREGE
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgtccagtcgtatcgatagagacgtgattaatgcgctaattgcaggacattttgcggac
cctttttccgtactcggaatgcaccagacccaagccggactggaagtccgcgccctatta
cctgacgccaccgacgtatgggtgattgagaccaaaaccggacgtaaagtcggcaaactg
gaatgtctcgatgctcgcggttttttctgcggcgttttacccagacgtaaaaatttcttt
cgctatcagctcgccgtggtctggcacggacagcaaaatctgatcgacgatccttaccgt
tttggtccattgattcaggaaatggatgcctggctgttatcggaaggtactcacctgcgt
ccttatgaaacgctgggtgcgcacgctgatacgatggacggtgtcaccggtacccgattt
tctgtctgggcgcctaatgcccgccgcgtttcggttgtaggacaatttaactactgggat
ggccgtcgccacccgatgcgtctgcgcaaagagagcggtatttgggagctgtttatccct
ggcgcgcataatgggcaactgtataaattcgaactgctcgacgcgaatggaaatctgcgc
attaaagctgacccgtatgcctttgaggcgcagatgcgtccggaaacggcgtcgatgatc
tgcggcttgccggagaaggtgacgcaaagcgaagaacgacaaaaagccaatcggtttgac
gcgccgatctcgatttacgaggtgcatttaggttcatggcgacgccatacggataacaac
ttctggctgagctaccgtgaactggccgatcagcttgtgccttacgccaaatggatgggc
tttacgcaccttgaactcttgccggttaacgaacatccgtttgacggcagctggggctac
cagccaaccgggctttatgcccccacccgtcggttcggcacgcgtgatgatttccgctat
ttcatcaatgcagctcacgcggcaggactgaatgtcattctcgactgggtaccgggccat
tttccgtccgatgagtttagcctggcggagtttgacggtacgcacctctatgagcacagc
gatccgcgcgaggggtatcaccaggactggaacacgttgatttataattatggccgtcgt
gaggtcagtaactacctggtgggtaatgctctgtactggatagagcgtttcgggattgat
gcgctgcgtgtggatgcggtggcctctatgatttaccgcgactacagccgtaaagaaggc
gagtggatcccgaacgagttcggcggtcgtgaaaacctggaagccattgagtttctgcgt
aataccaaccgcattattggcgaacaggtgcctggcgcggtcagcatggccgaagagtcg
acagactttgccggcgtgacgcgtccgccagaaatggggggactggggttctggtacaag
tggaatctgggctggatgcatgacactctggactacatgaagctggacccggtctaccgc
cagtaccatcacgataagctcaccttcggcatggtgtataaccataccgaaaattttgtc
ctgccgctgtcgcacgatgaagtcgttcacggtaaaaaatctatcctcgatcgtatgccg
ggcgatgcgtggcagaaattcgccaacctgcgcgcctactatggctggatgtgggccttc
cccggtaagaaactgttgtttatgggcaatgaatttgcccagggacgcgagtggaaccat
gacgtcagtctcgactggcatctgttggaagggggagataactggcaccacggtgttcag
cgtctggtgcgcgatctcaaccacacctatcgccaccataaggcgctgcatgagctggat
tttgatgcttacggctttgagtggctggtggtcgatgaccatgagcgctcggtgtttatt
ttcgtgcgtcgcgataaagccggtaacgagattattattgccagcaactttacgcctgtt
ccccgtcacgactatcgctttggcatcaaccagccaggacgctggcgtgaaatcctcaat
actgactcaatgcattatcacggtagcaacgctggcaatggtggcgtggtacatagcgat
gagatcgaaagtcatggccgtccgcactctcttagcctgaccttgccgccgctggcgacg
atctggctgatgcgggagggggaatga

DBGET integrated database retrieval system