KEGG   Salmonella bongori NCTC 12419: SBG_3212Help
Entry
SBG_3212          CDS       T01579                                 

Gene name
gun
Definition
endoglucanase (EC:3.2.1.4)
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SBG_3212 (gun)
Enzymes [BR:sbg01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     SBG_3212 (gun)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3522453..3523562)
Genome map
AA seq 369 aa AA seqDB search
MMTMLRGWITIVVMLTAMNAQAACTWPAWEQFKKDYMSQQGRVIDPGDARKITTSEGQSY
AMFFALAANDRPAFAQLFNWTQNNLAQGALHEHLPAWLWGQKDPDTWEVLDSNSASDGDI
WMAWSLLEAGRLWKETRYTEAGTALLKRIAREEVVNVPGLGSMLLPGKIGFAEANSWRFN
PSYLPPQLAQYFSRFGAPWSTLRETNLRLLLETAPKGFSPDWVRYEKKQGWQLKPEKTLI
SSYDAIRVYLWAGMMHDGDPQKARLLARFKPMATLTMKNGVPPEKVDVANGNAQGTGPVG
FSAALLPFLQNRDAQAVQRQRVADHFPGNDAYYNYVLTLFGQGWDQHRFRFTVKGELLPD
WGQECVSSR
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgatgactatgctgcgcggatggataacgattgtcgtcatgctgacggcaatgaatgca
caggcggcctgtacatggcctgcctgggaacagttcaaaaaagattacatgagtcaacag
ggacgtgttatcgatccgggcgacgcgcgaaaaatcaccacgtccgaagggcaaagctac
gcgatgttctttgccctggcggcaaacgatcgaccggcgtttgcgcaactgtttaactgg
acgcaaaacaatctggcgcagggagcgctgcatgaacatctgcccgcctggctgtgggga
caaaaagatcccgacacctgggaggtactggacagcaactctgcgtccgacggcgatatc
tggatggcatggtcgttgttggaagccggtcgtctgtggaaagagacacgttacaccgag
gcaggtacggcgctgttaaaacgcatcgcccgtgaagaggttgtgaatgtaccggggttg
ggttcgatgctgctgcctggcaaaatcggctttgccgaggcgaatagctggcgctttaac
ccaagttatctgccgccacagttagcgcaatacttcagtcgttttggcgcgccgtggtcg
acgctacgggaaaccaatttgcggcttttgctggaaactgcaccgaaaggtttctcgccg
gactgggtgcgttatgaaaaaaagcaaggctggcagttgaaaccggaaaaaacgcttatc
agtagctacgatgcgattcgcgtctatttatgggcgggaatgatgcatgacggtgatccg
caaaaagcgcgtttactggcgcgatttaaaccgatggcaacgttaacgatgaaaaacggc
gttccgccggagaaagtggatgtcgccaacggtaacgcacaagggacggggccggtcggg
ttttccgctgctttactgcccttcctgcaaaaccgtgatgcccaggccgtacaacggcaa
cgggtcgcagaccattttcctggcaacgacgcctattacaactatgtactgactctcttt
ggacaaggctgggatcagcaccgttttcgcttcaccgtcaaaggtgaattattacctgac
tggggccaggaatgcgtaagttcacgttaa

DBGET integrated database retrieval system