KEGG   Salmonella bongori NCTC 12419: SBG_3495Help
Entry
SBG_3495          CDS       T01579                                 

Gene name
pldB
Definition
lysophospholipase L2
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    SBG_3495 (pldB)
Enzymes [BR:sbg01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     SBG_3495 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3849014..3850180
Genome map
AA seq 388 aa AA seqDB search
MRSADRRTTIQRSCETPWLSVFVPQYATAAVLCQARHKKRFYLVNEAGYPMFQQQKDWET
RENAFAAFAMGPLTDFWRQREEAEFIGVDNIPVRFVRFRTDSNDRTIVICPGRIESYVKY
AELAYDLFHLGFDIFIIDHRGQGRSGRMLSDPHRGHVDHFNDYVDDLAAFWQQEVEPGPW
RKRYILAHSMGGAIATLFLQRHRVRCDAIALTAPMFGIVIRLPSFMVRHILDWAEGHQRI
REDYAIGTGQWRALPFGMNALTHSRQRYQRNLRFYADEPQLRVGGPTWHWVREGILAGEQ
VLAGASDDATPTLLIQAEEERVVDNRTHDRFCEIRAAAGHPCEGGKPLVIKGAYHEILFE
KDAMRSVALNAIVEFFNEPNLSSGNRFA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
ttgaggtcagcagataggcgaaccaccattcaaaggtcatgtgaaactccctggttgtct
gtttttgtgccacaatacgctactgccgctgtgttgtgtcaggcacgacacaaaaaacga
ttttacctggtaaacgaggctggatatccgatgtttcagcagcaaaaggactgggaaaca
agagaaaatgcgttcgctgcttttgccatggggccgctgacggatttctggcgtcagcgg
gaagaggcggaatttatcggcgtggacaatattccggtacgtttcgtccgtttccggacc
gattccaatgaccggaccatcgttatttgtcctggtcgcattgagagctacgtaaaatac
gccgaactggcgtatgacctctttcatcttgggtttgatatcttcatcatcgaccaccgc
gggcaagggcgttccgggcggatgttatcggacccgcatcgtggccatgtcgatcatttt
aatgattatgttgatgacttagcggcgttctggcagcaagaagttgagccgggaccgtgg
cgcaagcgttatattctggcgcactcaatgggcggcgcgatagccactctgttcctgcag
cgtcatcgtgtgcggtgcgacgctattgcgctcaccgcgccaatgtttggtattgtgata
cgcttgccttccttcatggtgcgccatattctcgactgggccgaagggcaccagcgtatc
cgtgaagattacgccattggaacaggtcagtggcgggcgttgccgtttggcatgaatgcg
ttaacccacagccgtcagcgctatcagcgcaacttacgtttttatgccgatgaaccacaa
ttgcgcgtcggcggccccacctggcactgggtgcgcgaaggtattctggcgggggaacag
gtactggcgggggcgagcgatgacgcgacgcctacactcctgattcaggcagaagaagag
cgggtagtagacaaccgcacccatgaccgtttttgtgaaatccgcgctgcggcgggacac
ccttgtgaagggggaaaaccgctggttatcaaaggcgcgtaccatgagatcctttttgaa
aaggacgccatgcgctcagtcgcgcttaacgccattgttgaatttttcaacgaacctaat
ttatccagcggaaatcgctttgcttag

DBGET integrated database retrieval system