KEGG   Salmonella bongori NCTC 12419: SBG_3514Help
Entry
SBG_3514          CDS       T01579                                 

Gene name
fadB
Definition
large (alpha) subunit of the fatty acid-oxidizing multienzyme complex
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SBG_3514 (fadB)
   01212 Fatty acid metabolism
    SBG_3514 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SBG_3514 (fadB)
   00650 Butanoate metabolism
    SBG_3514 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    SBG_3514 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    SBG_3514 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SBG_3514 (fadB)
   00310 Lysine degradation
    SBG_3514 (fadB)
   00380 Tryptophan metabolism
    SBG_3514 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SBG_3514 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SBG_3514 (fadB)
   00281 Geraniol degradation
    SBG_3514 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    SBG_3514 (fadB)
Enzymes [BR:sbg01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SBG_3514 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SBG_3514 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     SBG_3514 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     SBG_3514 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3869042..3871231)
Genome map
AA seq 729 aa AA seqDB search
MLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGQALDVLEKQHDLKGLLLRSN
KAAFIVGADITEFLSLFLVPEEQLSQWLYFANSVFNRLEDLPVPTLSAVNGYALGGGCEC
VLATDYRLATPDLRIGLPETKLGIMPGFGGSVRMPRMLGADSALEIIAAGKDVGAEQALK
MGLVDGVVKQEKLIDGAMAVLRQAIAGDLDWKAKRQPKLEPLHLSKIEAAMSFTIAKGMV
AQTAGKHYPAPITAVKTIEAAARFGREEALNLENKSFVPLAHTNEARALVGIFLNDQYVK
GKAKKLTKDVETPKQAAVLGAGIMGGGIAYQSAWKGVPVIMKDINDKSLTLGMTEAAKLL
NKQLERGKIDGLKLAGVISTIHPTLDYAGFDRVDVVVEAVVENPKVKKAVLAETEDKVRP
DTVLASNTSTIPISELAGALKRPENFCGMHFFNPVHRMPLVEIIRGEKSSDETIAKVVAW
ASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVMEKQFGWPMGPAYL
LDVVGIDTAHHAQAVMAAGFPQRMQKEYRDAIDALFDANRYGQKNGLGFWRYKEDSKGKP
KKEEDATVDSLLAEVSQSKRDFSDEEIIARMMIPMVNEVVRCLEEGVIASPAEADMALVY
GLGFPPFHGGAFRWLDTLGSAKYLDMAQQYQHLGPLYDVPEGLHHKARHNEPYYPQVEPA
RPVGGLKTA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgctttacaaaggcgacaccctgtacctcgactggctggaagatggcatcgccgaactg
gtgttcgatgccccaggctcggttaataaactcgacacggcgaccgttgccagcctcggc
caggcgcttgacgtgctggaaaagcaacacgatttaaaagggctgctgctgcgttccaac
aaagcagcctttattgtcggtgcggatatcaccgaatttctctctctgttccttgtgcct
gaagagcaattaagccagtggctgtattttgccaatagcgtcttcaatcgcctggaagac
ctgccggtacccaccctctcagccgtcaacggctatgcgttgggcggcggctgcgaatgc
gtactggccaccgactatcgtctggcaacgccggatctgcgcatcggtctaccggaaacc
aaactgggtatcatgccgggctttggcggctccgtgcgtatgccacgtatgctgggtgcc
gacagcgcgctggaaatcattgccgcaggtaaagatgtgggtgccgaacaggcattaaaa
atggggctggttgatggcgtggtcaaacaggagaagctgattgacggcgcgatggcggta
ctacgccaggcaattgccggcgatctggactggaaagccaaacgccaaccgaagctggaa
ccactacacttaagcaaaattgaagcggcgatgagcttcaccatcgccaaaggcatggtc
gcacaaacggccggaaaacattatccggcgccaataaccgcagtgaaaaccattgaagcg
gctgcgcgttttggccgtgaagaagcgctgaacctggaaaataaaagctttgttccgctg
gcgcataccaacgaagcccgcgcgctggttggaatcttccttaacgatcagtacgtgaaa
ggcaaagctaaaaagctgaccaaagacgttgagacgccgaagcaggccgcagtcctcggc
gcgggcatcatgggcggcggcatcgcttaccaatctgcatggaaaggcgtaccggtcatt
atgaaggatatcaacgacaaatcgttgaccctcggcatgacggaagccgccaagctgctg
aacaaacaactggagcgcggcaagatcgacggtctgaagctggcgggcgtcatttcgact
atccacccgactctcgattatgccggtttcgatcgcgtggatgtcgtggtcgaagcagtg
gtcgaaaatccaaaagtgaaaaaagcggtgctggcggaaaccgaagacaaagtgcgcccg
gataccgtcctggcctctaacacctcaaccattcccattagcgagttggctggcgcattg
aagcgtccggaaaacttctgcgggatgcacttctttaacccggtgcaccggatgccgctg
gttgaaatcattcgtggcgaaaaaagctcggatgagactatcgccaaagtggtggcctgg
gcgagcaaaatgggtaagacgccgatcgtggtcaatgactgtcccggtttctttgttaac
cgcgtgctattcccctattttgccggtttcagtcaactgctgcgcgacggcgcggatttc
cgcaaggtcgataaagtgatggaaaaacagttcggctggccgatgggcccggcctatttg
ctggatgttgtcggcattgataccgcgcatcacgcgcaggcggtaatggcggcaggcttc
ccgcaacggatgcagaaagagtatcgcgacgcgattgacgcgctgttcgatgctaaccgc
tacggtcagaaaaacggccttggcttctggcgttataaagaagacagcaaaggcaagccg
aagaaagaagaagacgccactgtagatagcctgctggctgaggttagccagtcgaagcgt
gacttcagcgacgaagagattatcgcccgcatgatgatcccgatggtcaacgaagtggta
cgttgtctggaagaaggcgttatcgccagtccggcagaggccgatatggcgctggtttat
ggtctgggtttccctccgttccacggcggtgccttccgctggctggatacgcttggcagc
gctaaatatctcgatatggcacagcagtatcagcacctcggcccgctgtatgacgtgccg
gaaggattgcatcacaaagcgcgccataacgaaccctactacccccaggttgagccagcc
cgtccggttggcggtctgaaaacggcttaa

DBGET integrated database retrieval system