KEGG   Salmonella bongori NCTC 12419: SBG_3653Help
Entry
SBG_3653          CDS       T01579                                 

Gene name
aceB
Definition
(GenBank) malate synthase A
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
sbg00620  Pyruvate metabolism
sbg00630  Glyoxylate and dicarboxylate metabolism
sbg01100  Metabolic pathways
sbg01110  Biosynthesis of secondary metabolites
sbg01120  Microbial metabolism in diverse environments
sbg01200  Carbon metabolism
Module
sbg_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SBG_3653 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    SBG_3653 (aceB)
Enzymes [BR:sbg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SBG_3653 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase HpcH_HpaI
Motif
Other DBs
NCBI-ProteinID: CCC32698
UniProt: A0A0K0HH18
Position
4046447..4048048
Genome map
AA seq 533 aa AA seqDB search
MNQQATTTDALIFTRPQGELEKQVLTAEAVEFLTELVTRFAPKRNKLLAARIQQQRDIDN
GRLPDFISETASIRNGNWTIRGIPEDLQDRRVEITGPVERKMVINALNANVKVFMADFED
SLAPDWNKVIDGQINLRDAVNGTISYTNEAGKIYQLKPDPAVLICRVRGLHLPEKHVTWR
GEAIPGSLFDFALYFFHNYKSLLAKGSGPYFYLPKTQSWQEAAWWSEVFSYAEDRFNLPR
GTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNYPDRVLPDRQV
VTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDAERNAQVLNKVKADKSLEANNG
HDGTWIAHPGLADTAMAVFNEVLGNNRNQLFVTRDEDAPITAEQLLEPCEGERTEAGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHEKTLSNGKPVTKALFR
DMLAEEMRVIQDELGEHRYSSGRFDDAARLMEQITTSDELIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaacaggcaacgacaactgatgcgttaatctttaccaggccgcaaggtgagctg
gagaagcaggttctgactgctgaagcggtagaatttctgacggagctggtcacgcgcttt
gcgcctaaacgtaataaactccttgccgcccgcattcaacagcagcgggacatcgataat
ggtagattgcctgattttatttcggaaactgcttccattcgtaatggcaactggacgatt
cgcggcattcctgaggacttacaggatcgtcgggtggagattaccggcccggttgaacgg
aaaatggtaattaatgcgctcaatgcaaacgtaaaagtctttatggccgattttgaagat
tcgctggcaccggactggaacaaagtcattgacggacaaatcaacctgcgtgatgcagta
aacggcaccattagctataccaacgaagccggaaaaatttaccagttgaaacccgatccg
gcggtactgatttgccgcgttcgcggcctgcatctaccggaaaaacatgtcacctggcgc
ggtgaggctattcccggtagtttgtttgattttgcgctctactttttccacaactacaaa
agcttgctggcgaaaggtagcggtccatatttctatctgccgaaaacgcagtcctggcag
gaagcagcctggtggagcgaagtcttcagctatgccgaagaccgcttcaacctgccgcgc
ggcacgatcaaagccacgctgttaattgaaacgctgcccgccgtgttccagatggacgag
atcttgcacgccctgcgcgatcatattgtgggtctgaactgtggtcgctgggattacatc
ttcagctatatcaagacattgaaaaactatccggatcgcgtcctgccggaccggcaggtg
gtaacgatggacaaaccgtttcttagtgcctactcacgcctgctgatcaaaacctgccat
aaacgtggtgcttttgcgatgggcggcatggcagcctttattccgagcaaagacgcagaa
cgcaacgcccaggtactgaacaaagtgaaggcggataaatccctggaagcgaataacggt
catgacggtacgtggattgcgcatcccggactggcggatactgcgatggctgtctttaac
gaggtgctgggtaacaacaggaaccaactgttcgtcacacgcgatgaagatgcgccgatt
actgctgagcagctactggaaccgtgtgaaggcgaacgtacagaagccggaatgcgcgcc
aacattcgtgtggcagtacagtacattgaagcatggatctccggcaatggctgtgtaccg
atttacggtctgatggaagatgccgcgacggcggaaatctcacgaacctctatttggcag
tggattcaccatgagaaaacactgagcaacggtaagccagtgactaaagcgctgttccgc
gacatgctggcggaagagatgcgggtaattcaggacgaactgggcgagcaccgctacagt
agcgggcgcttcgacgatgccgcgcgcctgatggaacagatcaccacctctgacgagtta
attgatttcctgaccttgccaggctaccgcctgctggcataa

DBGET integrated database retrieval system