KEGG   Salmonella bongori NCTC 12419: SBG_3653Help
Entry
SBG_3653          CDS       T01579                                 

Gene name
aceB
Definition
(RefSeq) malate synthase A (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SBG_3653 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SBG_3653 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    SBG_3653 (aceB)
Enzymes [BR:sbg01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SBG_3653 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4046447..4048048
Genome map
AA seq 533 aa AA seqDB search
MNQQATTTDALIFTRPQGELEKQVLTAEAVEFLTELVTRFAPKRNKLLAARIQQQRDIDN
GRLPDFISETASIRNGNWTIRGIPEDLQDRRVEITGPVERKMVINALNANVKVFMADFED
SLAPDWNKVIDGQINLRDAVNGTISYTNEAGKIYQLKPDPAVLICRVRGLHLPEKHVTWR
GEAIPGSLFDFALYFFHNYKSLLAKGSGPYFYLPKTQSWQEAAWWSEVFSYAEDRFNLPR
GTIKATLLIETLPAVFQMDEILHALRDHIVGLNCGRWDYIFSYIKTLKNYPDRVLPDRQV
VTMDKPFLSAYSRLLIKTCHKRGAFAMGGMAAFIPSKDAERNAQVLNKVKADKSLEANNG
HDGTWIAHPGLADTAMAVFNEVLGNNRNQLFVTRDEDAPITAEQLLEPCEGERTEAGMRA
NIRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHEKTLSNGKPVTKALFR
DMLAEEMRVIQDELGEHRYSSGRFDDAARLMEQITTSDELIDFLTLPGYRLLA
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaacaggcaacgacaactgatgcgttaatctttaccaggccgcaaggtgagctg
gagaagcaggttctgactgctgaagcggtagaatttctgacggagctggtcacgcgcttt
gcgcctaaacgtaataaactccttgccgcccgcattcaacagcagcgggacatcgataat
ggtagattgcctgattttatttcggaaactgcttccattcgtaatggcaactggacgatt
cgcggcattcctgaggacttacaggatcgtcgggtggagattaccggcccggttgaacgg
aaaatggtaattaatgcgctcaatgcaaacgtaaaagtctttatggccgattttgaagat
tcgctggcaccggactggaacaaagtcattgacggacaaatcaacctgcgtgatgcagta
aacggcaccattagctataccaacgaagccggaaaaatttaccagttgaaacccgatccg
gcggtactgatttgccgcgttcgcggcctgcatctaccggaaaaacatgtcacctggcgc
ggtgaggctattcccggtagtttgtttgattttgcgctctactttttccacaactacaaa
agcttgctggcgaaaggtagcggtccatatttctatctgccgaaaacgcagtcctggcag
gaagcagcctggtggagcgaagtcttcagctatgccgaagaccgcttcaacctgccgcgc
ggcacgatcaaagccacgctgttaattgaaacgctgcccgccgtgttccagatggacgag
atcttgcacgccctgcgcgatcatattgtgggtctgaactgtggtcgctgggattacatc
ttcagctatatcaagacattgaaaaactatccggatcgcgtcctgccggaccggcaggtg
gtaacgatggacaaaccgtttcttagtgcctactcacgcctgctgatcaaaacctgccat
aaacgtggtgcttttgcgatgggcggcatggcagcctttattccgagcaaagacgcagaa
cgcaacgcccaggtactgaacaaagtgaaggcggataaatccctggaagcgaataacggt
catgacggtacgtggattgcgcatcccggactggcggatactgcgatggctgtctttaac
gaggtgctgggtaacaacaggaaccaactgttcgtcacacgcgatgaagatgcgccgatt
actgctgagcagctactggaaccgtgtgaaggcgaacgtacagaagccggaatgcgcgcc
aacattcgtgtggcagtacagtacattgaagcatggatctccggcaatggctgtgtaccg
atttacggtctgatggaagatgccgcgacggcggaaatctcacgaacctctatttggcag
tggattcaccatgagaaaacactgagcaacggtaagccagtgactaaagcgctgttccgc
gacatgctggcggaagagatgcgggtaattcaggacgaactgggcgagcaccgctacagt
agcgggcgcttcgacgatgccgcgcgcctgatggaacagatcaccacctctgacgagtta
attgatttcctgaccttgccaggctaccgcctgctggcataa

DBGET integrated database retrieval system