KEGG   Salmonella bongori NCTC 12419: SBG_3654Help
Entry
SBG_3654          CDS       T01579                                 

Gene name
aceA
Definition
isocitrate lyase (EC:4.1.3.1)
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SBG_3654 (aceA)
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    SBG_3654 (aceA)
Enzymes [BR:sbg01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     SBG_3654 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4048205..4049509
Genome map
AA seq 434 aa AA seqDB search
MKTRTQQIEELQKEWTQPRWEGITRPYSAEDVVKLRGSVNPECTLAQLGAAKMWRLLHGE
AKKGYVNSLGALTGGQALQQAKAGIEAVYLSGWQVAADANLASSMYPDQSLYPANSVPAV
VDRINNTFRRADQIQWSSGIEPNDPRYVDYFLPIVADAEAGFGGVLNAFELMKSMIEAGA
AAVHFEDQLASVKKCGHMGGKVLVPTQEAIQKLVAARLAADVMGVPTLLVARTDADAADL
ITSDCDPYDSDFITGERTSEGFYRTQAGIEQAISRGLAYAPYADLVWCETSTPDLTLAQR
FADAIHAKYPGKLLAYNCSPSFNWQKNLDDKTIASFQQQLSDMGYKYQFITLAGIHSMWF
NMFDLAHAYAQGEGMKHYVEKVQQPEFAAGKEGYTFVSHQQEVGTGYFDKVTTIIQGGAS
SVTALTGSTEESQF
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacccgtacacaacaaatcgaagaattacagaaagaatggacccaaccgcgctgg
gaaggcattacccgcccgtatagcgcggaggatgtggtgaagttacgtggctcggtcaac
ccggaatgcacgctggcgcagctcggtgccgctaaaatgtggcgtctgctgcacggtgaa
gccaaaaaaggatatgttaacagcctcggcgcgctgaccggcggtcaggcgctacagcag
gcgaaagccggtattgaagcagtatatctgtcaggctggcaggtagcggcggatgccaac
ctcgcctccagcatgtacccggatcaatcgttgtacccggcgaactctgtaccggcggtg
gtggatcggatcaacaatacgttccgtcgtgcggatcagatccagtggtccagcggcatt
gagccgaacgatccgcgttatgtggattacttcctgccgatcgtcgctgatgccgaagcg
ggttttggcggcgtgctgaacgccttcgaactgatgaaatcgatgattgaggccggtgca
gcggcggtacacttcgaagatcagcttgcgtcggtgaaaaaatgcggacacatgggtggt
aaagtgctggtgccaacgcaggaagccattcagaagctggttgccgcgcgtctggcagcc
gatgtgatgggcgtcccgacgctgttggtggcccgtactgatgccgatgcagcggatctg
attacttctgattgcgacccatacgacagtgactttatcactggagagcgtaccagtgag
ggcttttaccgtacccaggcaggtattgagcaggcgatcagccgtggcctggcgtatgcg
ccgtatgccgacctggtgtggtgtgaaacctccacgccggatctgacgttggcacaacgc
tttgccgatgctattcacgcgaaatatccaggcaaattgttggcctacaactgctcaccg
tcgtttaactggcagaagaatctggatgataaaaccattgccagcttccagcagcagttg
tcggatatggggtacaagtatcagtttatcaccctggctggcattcacagcatgtggttc
aacatgtttgacctggcgcacgcgtatgcccagggcgaggggatgaagcactacgttgag
aaagtccagcagccagagttcgcggctgggaaagaaggctacaccttcgtctctcaccaa
caggaagtcggaacgggttactttgataaggtgactaccattattcagggcggcgcctct
tccgtcaccgcactgaccggttcgaccgaagaatcacagttctga

DBGET integrated database retrieval system