KEGG   Salmonella bongori NCTC 12419: SBG_3718Help
Entry
SBG_3718          CDS       T01579                                 

Gene name
acs
Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
sbg00010  Glycolysis / Gluconeogenesis
sbg00620  Pyruvate metabolism
sbg00640  Propanoate metabolism
sbg00680  Methane metabolism
sbg01100  Metabolic pathways
sbg01110  Biosynthesis of secondary metabolites
sbg01120  Microbial metabolism in diverse environments
sbg01130  Biosynthesis of antibiotics
sbg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBG_3718 (acs)
   00620 Pyruvate metabolism
    SBG_3718 (acs)
   00640 Propanoate metabolism
    SBG_3718 (acs)
  Energy metabolism
   00680 Methane metabolism
    SBG_3718 (acs)
Enzymes [BR:sbg01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SBG_3718 (acs)
Lipid biosynthesis proteins [BR:sbg01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SBG_3718 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: CCC32762
UniProt: A0A0K0HH69
Position
complement(4141377..4143335)
Genome map
AA seq 652 aa AA seqDB search
MSQTHKHAIPANIADRCLINPEQYEAKYQLSINDPNTFWGEQGKILDWITPYQTVKNTTF
APGNVSIKWYEDGTLNLAANCLDRHLAENGDRTAIIWEGDDASQSKHISYRELHRDVCRF
ANTLLNLGIKKGDVVAIYMPMVPEAAVAMLACARIGAVHSVIFGGFSPEAVAGRIIDSNS
RLVITADEGVRAGRGIPLKKNVDDALKNPHVTSVEHVVVLKRTGGNIDWQEGRDLWWSDL
IEKASPEHQPEAMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAATTFKYVFDYHPGDI
YWCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTA
IRALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGNEKCPVVDTWWQTETGG
FMITPLPGATELKAGSATRPFFGVQPALVDNEGHPLEGATEGNLVIVDSWPGQARTLFGD
HERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHP
KIAEAAVVGIPHSIKGQAIYAYVTLNHGEEPSPELYTEVRNWVRKEIGPLATPDVLHWTD
SLPKTRSGKIMRRILRKIAAGDTSNLGDTSTLADPGVVEKLLEEKQAIAMPS
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgagccaaacacataaacacgccattcccgccaacattgcggatcgttgcctgataaat
ccagagcagtatgaggctaaatatcaactgtctattaacgatcccaatacgttctggggc
gaacagggaaaaattctcgactggatcacgccgtaccaaaccgtaaaaaacaccaccttt
gcaccgggcaacgtatccattaaatggtacgaggatggcaccctgaatctggcggctaac
tgtctcgatcgtcacctggcggaaaatggcgatcgcaccgccattatctgggaaggcgat
gatgcttcccaaagcaaacatatttcttatcgcgaactccatcgggatgtctgccgtttc
gccaatacattgctgaatctgggcattaaaaagggtgacgtggtcgcgatttatatgccg
atggtgccggaagcggcggtagcaatgctggcatgtgcgcgtatcggcgctgtgcattcc
gtcatctttggcggcttctcgccggaagccgttgcgggccgtattattgattcaaactcc
cgtctggtgatcaccgctgatgaaggcgtacgcgccggacgcggcattccgctgaaaaag
aatgtcgacgatgcgctgaaaaatcctcatgtaaccagcgtagaacacgttgtggtactg
aaacgtaccggcggcaatattgactggcaggagggacgagacctgtggtggagcgatctg
attgagaaagccagtccggaacaccagcctgaagcgatgaacgccgaagatccgctgttt
atcctttatacctccggctcaaccggcaagccaaaaggcgtgttgcacaccaccggcggt
tatctggtctacgccgcaaccacgtttaagtatgtttttgattatcatcctggcgatatt
tactggtgtaccgctgacgtgggctgggtgacgggacacagttatctgttgtacggcccg
ctggcctgcggcgcgaccacattaatgtttgaaggcgtgccaaactggccgacgcccgct
cgcatgtgccaggtggtcgacaaacatcaggtcaacattctctataccgccccgacggca
attcgcgcactgatggccgaaggtgataaagccattgaaggcaccgaccgttcttcgctg
cgtatcctgggttccgtcggcgaaccgatcaacccggaagcctgggagtggtactggaag
aagatcggcaacgagaaatgtccagtggtcgacacctggtggcagaccgaaacgggcggt
ttcatgatcaccccattacctggcgcgacagaactgaaagcgggttccgccacccgtccg
ttctttggcgtacagcctgcgttagtggataacgaaggtcatccgctggaaggggccacc
gaaggcaacctggtgattgtcgattcctggccgggtcaggcgcggacgctgtttggcgat
catgaacgttttgagcaaacctatttttccaccttcaagaacatgtatttcagcggcgat
ggcgcgcgccgtgatgaagatggctactactggatcaccggccgcgtggatgatgtgtta
aacgtctccgggcaccgtctcggcacagcggaaatcgagtcggcgctggtggcgcatccg
aagattgccgaagcggcggtcgtggggatcccgcacagtattaaaggccaggcaatttac
gcttatgtaacgctgaaccatggcgaggagccgtcacctgagctgtacaccgaagtccga
aactgggtgcgtaaggagattggaccgctggcgacgccagatgtgttgcactggaccgac
tctctgcccaaaacccgttccggcaagatcatgcgccgtatcctgagaaaaattgcggca
ggcgataccagcaatctgggagacacctcaacgctcgccgatcctggcgttgttgagaag
ctgctcgaagagaagcaggccatcgcgatgccatcgtaa

DBGET integrated database retrieval system