KEGG   Salmonella bongori NCTC 12419: SBG_3848Help
Entry
SBG_3848          CDS       T01579                                 

Gene name
cysQ
Definition
cysQ protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:sbg00920]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4289016..4289756
Genome map
AA seq 246 aa AA seqDB search
MLEQVCQLARNAGDAIMQVYDGTKPMEFARKQDDSPVTAADIAAHTVILEGLRTLTPDIP
VLSEEDPPAWEVRQHWQRYWLVDPLDGTKEFIKRNGEFTVNIALIEQGRPVLGVVYAPVL
KVMYCAAEGKAWKEECGVRKQIQVRDARPPLVVISRSHTDDELTEYLQQLGEHQTTSIGS
SLKFCLVAEGQAQLYPRFGPTSIWDTAAGHAIAVAAGAHVHDWQGKTLDYTPRESFLNPG
FRVTIY
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgttagaacaagtatgtcagcttgcacggaacgcgggcgatgccattatgcaggtttat
gatggaaccaaaccgatggagttcgcccgcaagcaggacgattctccggtcaccgcggca
gatatcgccgcacataccgtgattctcgaggggttacgtacactcacgccggatattccg
gtgctttcggaggaagatccgcctgcctgggaagtgcgccagcactggcagcgttactgg
ctggtcgatccactcgacggcactaaagaattcattaagcgcaatggcgaatttacggtc
aatatcgcgttgattgagcagggcaggccggtactgggcgttgtctatgcgccagtgcta
aaagtcatgtactgcgcggcggaaggtaaggcctggaaagaagagtgtggggtacgtaag
cagattcaggtccgggatgcccgcccgccgctggtggtgattagccgttcacatacggat
gatgaactcaccgaatatctccagcagctcggcgaacatcagacgacgtctattggttct
tcgctgaagttttgtctggtggcggaaggacaggcgcagctttaccccagatttggaccg
accagcatctgggatacagccgcaggacatgctattgccgttgcagccggggcgcacgtt
cacgactggcagggaaaaacgctggattatactcctcgtgaatcgttccttaaccccggc
ttccgggtgactatttactga

DBGET integrated database retrieval system