KEGG   Salmonella bongori NCTC 12419: SBG_3979Help
Entry
SBG_3979          CDS       T01579                                 

Gene name
deoA
Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:sbg00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4430677..4431999
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLT
MAMRDSGTVLDWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDNRFREIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITGSILAKKLAEGLDALVMDVKVGSGAFMPTYELSEALAEAIVGVANGAGVRTTALLT
DMNQVLASSAGNAVEVREAVQFLTGEYRNPRLFDVTMALCVEMLISGNLAKDDAEARAKL
QAVLDNGKAAEVFGRMVAAQKGPSDFVENYDKYLPTAMLSKAVYADTEGFISAMDTRALG
MAVVSMGGGRRQASDTIDYSVGFTDMARLGDSIDGQRPLAVIHAKDEASWQEAAKAVKAA
IILDDKAPASTPSVYRRITE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgtttctcgcacaagaaattattcgtaaaaagcgtgatggtcatgcgttgagtgacgaa
gaaattcgtttctttatcaatggcattcgtgacaatactatctcagaaggacagattgcc
gccctggcgatgaccattttcttccacgatatgaccatgccggagcgtgtttcgctgacc
atggcgatgcgggattccggtactgttcttgactggaaaagcctgaatctcaatggcccg
attgtcgataagcattcgaccggcggcgtgggggacgtgacgtctctgatgttggggcca
atggtagccgcctgcggcggttatgtgccgatgatctccggtcgtggcctcggtcacacc
ggtggtacgctcgataaactggaggcgatcccggggtttgatatcttcccggacgacaac
cgtttccgcgaaattattaaagacgtaggtgtggcgattattgggcaaaccagttcgctt
gcaccggcagataaacgtttttacgccacccgtgatattaccgcgacggtggactctatc
ccgctgattaccggctccatcctcgccaaaaaactggccgaagggctggatgcgctggtg
atggacgtaaaagtcggcagcggcgcgtttatgccgacctatgaactttctgaagccctt
gctgaagccattgtcggcgtggcaaacggcgcgggagttcgcactacggcgttgttaacc
gatatgaaccaggtgctggcttcgagcgccggtaacgcggtggaagtgcgtgaagccgtg
cagttcctgaccggtgaataccgcaatccgcgcctgtttgacgtcaccatggccctgtgt
gtggagatgctgatctccggcaatctggcgaaagatgacgccgaagcccgcgcgaaattg
caggcggtgctggataacggtaaagcggcagaagtctttggtcgtatggtggccgcgcag
aaagggccgagcgatttcgttgagaactacgataaatacctgccgaccgccatgttgagc
aaagcagtatatgctgatactgaagggtttatcagcgcaatggatacccgtgcgttaggc
atggctgttgtgtcgatgggcggcggtcgtcgtcaggcgtcggacactattgattacagc
gtcggctttaccgatatggcgcgtctgggcgacagcattgatggacagcgtccgctggcg
gtgatccacgctaaagacgaagccagctggcaggaggcggcgaaagctgttaaagcggca
attatccttgacgataaagcaccagcaagcacaccttcggtctatcgtcgtattactgaa
tag

DBGET integrated database retrieval system