KEGG   Salmonella bongori NCTC 12419: SBG_3979Help
Entry
SBG_3979          CDS       T01579                                 

Gene name
deoA
Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
sbg  Salmonella bongori NCTC 12419
Pathway
sbg00240  Pyrimidine metabolism
sbg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbg00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SBG_3979 (deoA)
Enzymes [BR:sbg01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     SBG_3979 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N
Motif
Other DBs
NCBI-ProteinID: CCC33019
UniProt: A0A0K0HHR4
Position
4430677..4431999
Genome map
AA seq 440 aa AA seqDB search
MFLAQEIIRKKRDGHALSDEEIRFFINGIRDNTISEGQIAALAMTIFFHDMTMPERVSLT
MAMRDSGTVLDWKSLNLNGPIVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLEAIPGFDIFPDDNRFREIIKDVGVAIIGQTSSLAPADKRFYATRDITATVDSI
PLITGSILAKKLAEGLDALVMDVKVGSGAFMPTYELSEALAEAIVGVANGAGVRTTALLT
DMNQVLASSAGNAVEVREAVQFLTGEYRNPRLFDVTMALCVEMLISGNLAKDDAEARAKL
QAVLDNGKAAEVFGRMVAAQKGPSDFVENYDKYLPTAMLSKAVYADTEGFISAMDTRALG
MAVVSMGGGRRQASDTIDYSVGFTDMARLGDSIDGQRPLAVIHAKDEASWQEAAKAVKAA
IILDDKAPASTPSVYRRITE
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
gtgtttctcgcacaagaaattattcgtaaaaagcgtgatggtcatgcgttgagtgacgaa
gaaattcgtttctttatcaatggcattcgtgacaatactatctcagaaggacagattgcc
gccctggcgatgaccattttcttccacgatatgaccatgccggagcgtgtttcgctgacc
atggcgatgcgggattccggtactgttcttgactggaaaagcctgaatctcaatggcccg
attgtcgataagcattcgaccggcggcgtgggggacgtgacgtctctgatgttggggcca
atggtagccgcctgcggcggttatgtgccgatgatctccggtcgtggcctcggtcacacc
ggtggtacgctcgataaactggaggcgatcccggggtttgatatcttcccggacgacaac
cgtttccgcgaaattattaaagacgtaggtgtggcgattattgggcaaaccagttcgctt
gcaccggcagataaacgtttttacgccacccgtgatattaccgcgacggtggactctatc
ccgctgattaccggctccatcctcgccaaaaaactggccgaagggctggatgcgctggtg
atggacgtaaaagtcggcagcggcgcgtttatgccgacctatgaactttctgaagccctt
gctgaagccattgtcggcgtggcaaacggcgcgggagttcgcactacggcgttgttaacc
gatatgaaccaggtgctggcttcgagcgccggtaacgcggtggaagtgcgtgaagccgtg
cagttcctgaccggtgaataccgcaatccgcgcctgtttgacgtcaccatggccctgtgt
gtggagatgctgatctccggcaatctggcgaaagatgacgccgaagcccgcgcgaaattg
caggcggtgctggataacggtaaagcggcagaagtctttggtcgtatggtggccgcgcag
aaagggccgagcgatttcgttgagaactacgataaatacctgccgaccgccatgttgagc
aaagcagtatatgctgatactgaagggtttatcagcgcaatggatacccgtgcgttaggc
atggctgttgtgtcgatgggcggcggtcgtcgtcaggcgtcggacactattgattacagc
gtcggctttaccgatatggcgcgtctgggcgacagcattgatggacagcgtccgctggcg
gtgatccacgctaaagacgaagccagctggcaggaggcggcgaaagctgttaaagcggca
attatccttgacgataaagcaccagcaagcacaccttcggtctatcgtcgtattactgaa
tag

DBGET integrated database retrieval system