KEGG   Streptomyces bingchenggensis: SBI_00130Help
Entry
SBI_00130         CDS       T01678                                 

Definition
putative streptomycin-6-phosphate phosphatase
Orthology
K04342  
streptomycin-6-phosphatase [EC:3.1.3.39]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Streptomycin biosynthesis
Biosynthesis of secondary metabolites
Class
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:sbh00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(123767..125125)
Genome map
AA seq 452 aa AA seqDB search
MHRPSRRHLVIGTAVVAATAAAVAVSTTAGASDSKDRAESAIKGGKAKNVILLIGDGMGD
SEITLARDYTAGANGRLNMDKFPLTGAYTTYAVHADGTPDYVTDSAASGTGWATGRKTVN
GRISKTPDTDKAIPTVLELAQKNGYATGSVTTAELTDATPAVLASHATDRSCQGPADMAK
CPTDTIAAGGPGSIAEQSVNHKVDVLFGGGKARFDQKVTDGTYKGLTVTEQARKLGYQVV
TDSAGMKSAQAGKPVLGLFASGNVPTEWTGKTAAVGGTDPQRCVTSNPNRPSTTPSLADS
ATKAIQLLEAKQKHSGKGFFLQIEGASIDKQDHAADPCGQIGETAAFDRAVKVARDYAAK
HPDTLVVTTADHGHTSQIVPLEATPPGLSSTLVTNEGQQLKVNYSTNTPGQSQEHTGTQV
RIAGQGPQAYRVLGVTNQTDLFATIREALNLR
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgcacagaccctcccgtcgtcacctcgtgatcggcaccgccgtggtcgccgccaccgcg
gccgcagtggccgtcagcaccaccgccggagcctccgacagcaaggaccgcgccgagagc
gcgatcaagggtggcaaggcaaagaacgtcatcctgctgatcggcgacggtatgggcgac
tcggagatcaccctcgcccgtgactacacggcgggcgcgaacggccgcctgaacatggac
aagttcccgctcaccggcgcctacaccacctatgcggtgcacgccgacggcaccccggac
tacgtcacggactccgccgccagcggcaccggctgggcgaccggccgcaagacggtcaac
ggccgcatctccaagaccccggacaccgacaaggcgatccccaccgtcctggagctggcg
cagaagaacggctacgccaccggcagcgtcaccaccgccgagctcaccgacgccaccccg
gccgtgctcgcctcgcacgccaccgaccgctcctgccagggcccggccgacatggccaag
tgccccaccgacaccatcgccgccggcggccccggctcgatcgccgagcagtccgtcaac
cacaaggtcgacgtcctcttcggcggcggcaaggcgcggttcgaccagaaggtcaccgac
ggtacgtacaagggcctgaccgtcaccgagcaggcgcggaagctgggctaccaggttgtc
accgactccgccggtatgaagagcgcgcaggccggcaagccggtgctgggtctgttcgcc
tcgggcaatgtgcccaccgagtggaccggcaagacggccgcggtcggcggtacggacccg
cagcggtgcgtgacctcgaaccccaaccgcccgtcgaccacgccgagtctggccgactcc
gccaccaaggcgatccagctgctggaggccaagcagaagcactcggggaagggcttcttc
ctgcagatcgagggtgcctccatcgacaagcaggaccacgcggccgacccgtgcggccag
atcggcgagaccgccgccttcgaccgtgccgtgaaggtggcccgcgactacgccgccaag
caccccgacacgctcgtcgtgaccaccgccgaccacggtcacaccagccagatcgtcccg
ctggaggccaccccgcccggtctgtcctccaccctggtcaccaacgagggccagcagctc
aaggtcaactactccaccaacaccccgggccagtcccaggagcacaccggtacccaggta
cgcatcgcaggccaggggccgcaggcgtaccgcgtcctcggtgtcaccaaccagaccgac
ctgttcgccaccatccgcgaggctctgaacctgcgctga

DBGET integrated database retrieval system