KEGG   Streptomyces bingchenggensis: SBI_00945Help
Entry
SBI_00945         CDS       T01678                                 

Definition
(GenBank) class II aldolase/adducin family protein
  KO
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    SBI_00945
Enzymes [BR:sbh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     SBI_00945
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1358957..1359724)
Genome map
AA seq 255 aa AA seqDB search
MTQQTPATLPPLARRLRAHVAVAARSLSLGGHDDFNQGQVSARAPGADYMLIKGALKGFD
ECVPDDVIVAPVDPAVPSPALAPPELALHQAVYRARPDVNAIVHSHAPHTLVFGATDLAL
RAVSHEGAYFEGRLPRYTLTSNTILDIATGEQVADALGDNPAALLRNHGGVIVGKSIRHA
TVHAHTLERACRLQLMAEQLPGGYHSSSLEDVDGKRAFIYADLSVRSYWDHAVGQVQRRW
PEAADWPSQAAREAA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtgacccagcaaaccccggccacgctgccgcccctcgcccgtcggctgcgggctcatgtc
gccgtcgcggcacgttcactgtcactgggcggccacgacgacttcaaccaggggcaggtt
tccgcccgggcgcccggcgccgactacatgctgatcaagggcgcgctcaagggcttcgac
gaatgcgtacccgacgatgtgatcgtggcgccggtcgaccccgccgtaccgtcccccgcg
ctggcgcccccggagctggcgctgcaccaagcggtgtaccgggcgcgtcccgatgtcaac
gcgatcgtgcacagccacgcaccgcacaccctggtgttcggggcgaccgacctggccctg
cgcgccgtatcgcacgagggcgcctatttcgagggccggctgccccgttacacgctgacc
agcaacaccatcctcgacatcgccacgggggagcaggtggccgacgccctcggggacaac
ccggcggcgctgctgcgcaaccacggtggtgtgatcgtcggcaagtccatcagacatgcg
acggtgcacgcacacaccctggagcgcgcctgccgtctccagctgatggccgagcagcta
ccgggtggctaccactcctcctcactcgaggacgtggacggcaaacgggccttcatctac
gccgatctctccgtccgctcctactgggaccacgccgtcggacaggtacagcgccgctgg
ccggaagccgccgactggccgtcccaggccgcgcgggaggccgcgtga

DBGET integrated database retrieval system