KEGG   Streptomyces bingchenggensis: SBI_00945Help
Entry
SBI_00945         CDS       T01678                                 

Definition
class II aldolase/adducin family protein
Organism
sbh  Streptomyces bingchenggensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1358957..1359724)
Genome map
AA seq 255 aa AA seqDB search
MTQQTPATLPPLARRLRAHVAVAARSLSLGGHDDFNQGQVSARAPGADYMLIKGALKGFD
ECVPDDVIVAPVDPAVPSPALAPPELALHQAVYRARPDVNAIVHSHAPHTLVFGATDLAL
RAVSHEGAYFEGRLPRYTLTSNTILDIATGEQVADALGDNPAALLRNHGGVIVGKSIRHA
TVHAHTLERACRLQLMAEQLPGGYHSSSLEDVDGKRAFIYADLSVRSYWDHAVGQVQRRW
PEAADWPSQAAREAA
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
gtgacccagcaaaccccggccacgctgccgcccctcgcccgtcggctgcgggctcatgtc
gccgtcgcggcacgttcactgtcactgggcggccacgacgacttcaaccaggggcaggtt
tccgcccgggcgcccggcgccgactacatgctgatcaagggcgcgctcaagggcttcgac
gaatgcgtacccgacgatgtgatcgtggcgccggtcgaccccgccgtaccgtcccccgcg
ctggcgcccccggagctggcgctgcaccaagcggtgtaccgggcgcgtcccgatgtcaac
gcgatcgtgcacagccacgcaccgcacaccctggtgttcggggcgaccgacctggccctg
cgcgccgtatcgcacgagggcgcctatttcgagggccggctgccccgttacacgctgacc
agcaacaccatcctcgacatcgccacgggggagcaggtggccgacgccctcggggacaac
ccggcggcgctgctgcgcaaccacggtggtgtgatcgtcggcaagtccatcagacatgcg
acggtgcacgcacacaccctggagcgcgcctgccgtctccagctgatggccgagcagcta
ccgggtggctaccactcctcctcactcgaggacgtggacggcaaacgggccttcatctac
gccgatctctccgtccgctcctactgggaccacgccgtcggacaggtacagcgccgctgg
ccggaagccgccgactggccgtcccaggccgcgcgggaggccgcgtga

DBGET integrated database retrieval system