KEGG   Streptomyces bingchenggensis: SBI_00994Help
Entry
SBI_00994         CDS       T01678                                 

Definition
putative acyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SBI_00994
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBI_00994
   00620 Pyruvate metabolism
    SBI_00994
   00640 Propanoate metabolism
    SBI_00994
  Energy metabolism
   00680 Methane metabolism
    SBI_00994
Enzymes [BR:sbh01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SBI_00994
Lipid biosynthesis proteins [BR:sbh01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SBI_00994
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1436124..1437761)
Genome map
AA seq 545 aa AA seqDB search
MTSPEQRMADLLKTFGDPAACTAHLLCDRHPADAVAFTVVGADLDGHDMTYGELRESSAR
MASALAALGVGPGDRVATLMSKSAELLVATLAIWRTGAVQVPLFTAFAPPAIALRVTGNG
TKVVITDAGQRPKLAAGPDLPTDQPWRIITTGPTEEGDLSFAELLAGHPPLDEAAVVGGD
ATIVELFTSGTSGPPKAVPIPLRAVAGFAMYQEFGLDHRPTDVFWNAADPGWAYGLYYAI
IAPLALGLRSLLYNSLFSAEGTWAVLSRFNVTNFTAGPTVYRKLRGTPAPDDVRLRCASA
AGEPLPADVVSWAERTLGIPVRDHYGSTELGMAIANAWHPALRTDLKPGSMGRPLPGWSV
TVLREDTNSAVAEAGMPGRVAMDITKSPLMWFEGYRDAPERTAEKFSPDGHWFYSGDTAS
RDEDGHLFFSGRSDDVILMAGYRIGPFEVESVLLEHEAVAEAAAVGVPHEEHGEVMEAFV
VLRAGASSPSDPDALAAELQQLVKDRLAKHAYPRRVHFVTELPKTSSGKTQRFLLRPRQV
SSRTR
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
ttgaccagcccggaacagcgcatggccgacctgctcaagaccttcggagatccggcggcg
tgcaccgcccatctgctgtgcgaccggcacccggccgacgccgtcgccttcacggtggtc
ggcgccgacctcgacgggcacgatatgacctacggcgaactgcgcgagtcctccgcgcgg
atggcgagcgccctggcggccctcggggtgggccccggcgaccgggtcgccaccctgatg
agcaagtccgccgaactgctcgtcgcgacactcgcgatctggcggacaggcgccgtccag
gtgcccctgttcacggcgttcgcgcccccggccatcgccctgcgggtcaccggcaatggc
accaaggtcgtgatcacggacgccgggcagcgccccaagctggccgcgggccccgacctc
cccaccgaccagccgtggcggatcatcaccaccgggcccaccgaggaaggcgacctgtcg
ttcgccgagctgctcgcgggacacccgccgctggacgaggcggccgtcgtcggcggggac
gccaccatcgtggagctcttcacctccggcacctccggcccgcccaaggccgtgcccatc
ccgctgcgggccgtcgcgggattcgccatgtaccaggagttcggcctcgaccaccggccc
accgatgtgttctggaacgccgccgacccgggctgggcctacgggctgtactacgcgatc
atcgccccgctcgccctcggcctgcgcagcctgctgtacaacagcctgttctccgccgag
ggcacatgggcggtgctgtcccgcttcaacgtcaccaacttcaccgcgggccccaccgtc
taccgcaagctgcgcggcacgcccgcccccgacgacgtgcggctgcgctgcgcctccgcg
gccggtgagccgcttccggccgacgtggtcagctgggcggagcggacactcggcatcccg
gtgcgcgaccactacggctccaccgaactgggcatggccatcgccaacgcctggcacccc
gcgctgcgcaccgacctcaagcccggctccatgggccggccgctgcccggctggagcgtc
accgtcctgcgcgaggacaccaactccgccgtcgccgaggccggtatgcccggccgggtg
gcgatggacatcaccaagagcccgctgatgtggttcgagggctaccgcgacgccccggag
cgcaccgcggagaagttcagccccgacggacactggttctactccggcgacaccgcctcc
cgggacgaggacggccacctgttcttctccgggcgcagcgacgacgtgatcctgatggcg
gggtaccgcatcggcccgttcgaggtggagagcgtgctgctggaacacgaggcggtggcc
gaggcggccgcggtcggcgtcccccacgaggaacacggcgaggtcatggaggccttcgtg
gtgctgcgcgcgggggcgtcgtcgccctcggaccccgacgccctcgccgccgagctgcag
cagctggtcaaggaccggctggccaagcacgcctacccgcggcgcgtgcacttcgtcacc
gagctgcccaagacctcgagcggcaagacccagcgttttctgctgcgcccgcgccaggtc
agctcccgcactcgctga

DBGET integrated database retrieval system