KEGG   Streptomyces bingchenggensis: SBI_01088Help
Entry
SBI_01088         CDS       T01678                                 

Gene name
echA1
Definition
(GenBank) enoyl-CoA hydratase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00071  Fatty acid degradation
sbh00280  Valine, leucine and isoleucine degradation
sbh00281  Geraniol degradation
sbh00310  Lysine degradation
sbh00360  Phenylalanine metabolism
sbh00362  Benzoate degradation
sbh00380  Tryptophan metabolism
sbh00410  beta-Alanine metabolism
sbh00627  Aminobenzoate degradation
sbh00640  Propanoate metabolism
sbh00650  Butanoate metabolism
sbh00903  Limonene and pinene degradation
sbh00930  Caprolactam degradation
sbh01100  Metabolic pathways
sbh01110  Biosynthesis of secondary metabolites
sbh01120  Microbial metabolism in diverse environments
sbh01130  Biosynthesis of antibiotics
sbh01212  Fatty acid metabolism
Module
sbh_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SBI_01088 (echA1)
   00650 Butanoate metabolism
    SBI_01088 (echA1)
  Lipid metabolism
   00071 Fatty acid degradation
    SBI_01088 (echA1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SBI_01088 (echA1)
   00310 Lysine degradation
    SBI_01088 (echA1)
   00360 Phenylalanine metabolism
    SBI_01088 (echA1)
   00380 Tryptophan metabolism
    SBI_01088 (echA1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SBI_01088 (echA1)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SBI_01088 (echA1)
   00281 Geraniol degradation
    SBI_01088 (echA1)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SBI_01088 (echA1)
   00627 Aminobenzoate degradation
    SBI_01088 (echA1)
   00930 Caprolactam degradation
    SBI_01088 (echA1)
Enzymes [BR:sbh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SBI_01088 (echA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ADI04209
UniProt: D7C848
Position
complement(1562474..1563280)
Genome map
AA seq 268 aa AA seqDB search
MTSGTEHLTVERAGATLVLTLNRPEAKNALSLPMLVGLHDGWAQADEDDDIRSVVLTGAG
GVFCAGMDLKALAGGDGMAGQHYRDRLKADPDLHWKAMLRHHRPRKPVIAAVEGHCVAGG
TEILQGTDIRVAGHGATFGLFEVRRGLFPIGGSTVRLARQVPRTHALEMLLTGRPYTAEE
AARIGLIGRVVPDGTALETALEIAELINANGPLAVEAVKASVYETAEMTEADGLKSELER
GWPIFATADAKEGSKAFAEKRPPVYRRA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
gtgacaagcgggaccgaacatctgacggttgagcgcgccggcgcgacgctggtgctcacc
ctgaaccgtccggaggccaagaacgcgctctcgctgccgatgctggtcggcctccacgac
ggctgggcacaggccgacgaggacgacgacatccggtcggtggtgctcaccggggccggc
ggggtcttctgcgcgggcatggacctcaaggccctggcgggcggcgacgggatggccgga
cagcactaccgggaccggctcaaggccgatcccgatctgcactggaaggcgatgctccgg
caccaccggccgcgtaaaccggtgatcgccgccgtcgaaggacactgtgtcgcgggcggc
accgaaatcctccagggcaccgacatccgcgtcgcgggccacggcgccaccttcgggctc
ttcgaggtcaggcgcggtctgttccccatcggcggctccaccgtccgcctcgcccgccag
gtcccgcgcacccacgcgctggagatgctgctgaccgggcggccgtacaccgccgaggag
gccgcgcggatcgggctgatcggccgggtcgtacccgacggcacggccctggagaccgcc
ctggagatcgccgagctgatcaacgccaacggcccgctcgccgtcgaggccgtcaaggcg
tccgtgtacgagacggcggagatgaccgaggccgacggcctgaaatccgaactcgaacgc
ggctggcccatcttcgccaccgccgacgcgaaggagggctcgaaggccttcgcggagaag
cgaccgccggtctaccgacgggcctga

DBGET integrated database retrieval system