KEGG   Streptomyces bingchenggensis: SBI_01534Help
Entry
SBI_01534         CDS       T01678                                 

Definition
acetaldehyde dehydrogenase
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    SBI_01534
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SBI_01534
   00650 Butanoate metabolism
    SBI_01534
  Amino acid metabolism
   00360 Phenylalanine metabolism
    SBI_01534
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SBI_01534
   00622 Xylene degradation
    SBI_01534
   00621 Dioxin degradation
    SBI_01534
Enzymes [BR:sbh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     SBI_01534
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2072890..2073795
Genome map
AA seq 301 aa AA seqDB search
MSKAIAAIVGPGNIGTDLLAKLLHGETVDVRYMVGVDPASDGLARARDLGLETSAEGVDW
LLSRDELPELVFEATSAKAHIANAKRYAEAGIQAIDLTPAAVGPLVCPPVNLGEHLDAPN
INMITCGGQATIPIVHAVSRVVPVAYAEIVASIASRSAGPGTRANIDEFTETTAQAIEQV
GGARKGKAVIIMNPVEPPMIMRDTVFCAIPEDADRDAISESIVRMVDEAAEYVPGYTLRA
DPQFDDPRPEWKDQARVAVFLEVRGRGDYLPPWAGNLDIMTAAAARVGELLAGAKTTAVT
S
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaggcgatcgcggccatcgtcggccccggcaacatcggcaccgatctgctggcc
aagctgctgcacggcgagacggtcgacgtgcgctacatggtcggcgtcgacccggcctcg
gacggcctcgcccgggcacgcgacctgggcctggagacgtccgcggagggagtcgactgg
ctgctgtcccgcgacgagctgcccgagctggtcttcgaggcgacctcggcgaaggcgcat
atcgccaacgcgaagcgctacgccgaggcaggcatccaggcgatcgacctgacgccggcg
gcggtgggcccgctggtctgcccgccggtgaacctgggtgagcacctggacgcccccaac
atcaacatgatcacctgcggcggacaggccaccatcccgatcgtgcacgcggtctcccgc
gtggtgccggtcgcgtacgccgagatcgtcgcgtcgatcgcctcccggtccgccggaccc
ggcacccgcgcgaacatcgacgagttcaccgagaccaccgcgcaggcgatcgagcaggtc
ggtggcgcccgcaagggcaaggccgtgatcatcatgaacccggtcgaaccgccgatgatc
atgcgggacaccgtgttctgcgcgatcccggaggacgccgaccgcgacgcgatcagtgag
tcgatcgtccgcatggtcgacgaggcggccgagtacgtgcccggctacacgctgcgcgcc
gacccgcagttcgacgacccgcgccccgagtggaaggaccaggcgcgggtggctgtcttc
ctggaggtgcgcggccggggcgactacctgccgccctgggccggaaacctggacatcatg
acggccgcggccgctcgcgtgggcgagctgctggcgggcgcgaagacgacggcggtgacc
tcatga

DBGET integrated database retrieval system