KEGG   Streptomyces bingchenggensis: SBI_01594Help
Entry
SBI_01594         CDS       T01678                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:sbh00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2168561..2170405
Genome map
AA seq 614 aa AA seqDB search
MNGWWVVLPDTEAAAALAARLRHDKSDEGASNCLRHASGRPWLVGRRVDGRMLAVQAGAT
RLALSGRFTVSPEELRRKAARARSAQEVEQAVAGLAGSCHVLASVDGSVWARGTASAACR
VFTARVDGVPVAASDADVLAELVGSAPDMEMLAARLLEPGVSWAALGGRTMWQGVHAVRP
DEALIWPRDGSGRTVRWWCPPEPVLPLGEAAQAVRAALLEAVDTCTAGGGTVSADLSGGL
DSTSLCFLAARGDTALVTARWEGVDARNDDAAWAAQAARELPEATHLVVGRGETPDWFAG
LGSLRLAAQEPGPWTRDVAKLDDLLRRVHARGSRLHMGGGGGDELFTPAPSHWIDALTQH
PGLVLKRARRQRLDWRVSRWAMLRALTARRGYHRWLLEAADHLTAPHTHGPADHLGWQPV
PRMPAWASPQAARSARDVLREAAEHCPEPLAPQRGLHAVLHQVREGGNTVRLINKSLPGP
DLALPYTDDAVVAAALSVRPWEAAAPGRFKPLLTTAMAGIVPEQILGRTTKGQYCADFYR
ALDRQRGKISTLLDGSLLAEAGLIDPDRLRRVAHSHASIADLAPLMSTVGCEIWLRSQER
TPHHLTSTLTGAMP
NT seq 1845 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgggtggtgggtggtgttgccggacacggaggccgccgccgcgctggcggcgcgg
ctgcggcatgacaaatccgacgagggcgcgtcgaactgtctgcggcacgcgtcgggcaga
ccgtggctggttggccggcgggtcgacgggcgcatgctcgccgtccaggcgggggccacg
cggctcgccctgtcgggcaggttcaccgtctccccggaggaactgcgccggaaggccgct
cgggcgcgcagcgcgcaggaggtggagcaggcggtcgccgggctggcgggcagctgtcac
gtgctggcctcggtggacggcagcgtgtgggcacgggggacggcttctgcggcgtgtcgc
gtcttcaccgcgcgcgtggacggcgtaccggtggcggcttcggacgcggatgtgctggcc
gagctggtcggttcggcaccggacatggagatgctggcggcgcggctgctggaacccggt
gtgtcatgggcggcgttgggcggacgcacgatgtggcagggggtgcatgccgtacggccc
gacgaggcactgatatggcctcgcgacggcagcggacgcacggtgcgctggtggtgccct
cccgagcctgtcctccctctgggcgaggcggcacaggcggtgcgcgccgcgctcctggag
gcggtggacacatgtacggcgggcgggggaacggtcagcgccgatctgtccggcgggctg
gattcgacgagcttgtgctttctggccgcccgcggtgacaccgcgttggtgacggcgcgc
tgggagggcgtggacgcgcgcaacgacgatgccgcgtgggccgcccaggccgctcgggaa
ctgcccgaggccacgcatctggtggtcgggcggggcgagacgcccgactggttcgcaggg
ctggggtcgctccgcctggccgcccaggagcccggcccctggacgcgggatgtcgcgaag
ctggacgacttgctgcgccgcgtccacgcacgcggatcccggctgcacatgggcggcgga
ggcggcgacgagctgttcacccccgccccctcccactggatcgacgccctgacgcagcac
ccggggctggtgctcaagcgggcccggcggcaacgcctcgactggcgcgtcagccgctgg
gccatgcttcgggcgctgacggcccggcgcggctaccaccggtggctgctggaggcggcc
gaccatctgaccgccccgcacacgcacgggccggcggatcacctcggctggcagccggtg
ccccgtatgcccgcgtgggcctccccgcaggccgcccgctcggcgcgggacgtgctacgg
gaggccgccgaacactgccccgagccgctcgctccccaacgcggcctccacgccgtactg
caccaggtacgggaaggcggcaacaccgtgcgcctgatcaacaagtccctgccaggcccc
gatctcgcgctgccctacaccgacgacgccgtggtggcagccgccctgtccgtccgcccc
tgggaggccgcggccccgggacgcttcaaaccgctgctgacaaccgcgatggccggcatc
gttcccgagcagatcctggggcgcaccacaaagggccaatactgtgcggacttctatcgc
gccctggatcggcagcgcggcaaaatctccacgcttctggacggttcgctgctggccgag
gccggcctgatcgaccccgaccgcctgcgccgcgtcgcgcattcacacgcgtcgatcgcc
gacctggcaccgctgatgtccacggtgggctgcgaaatctggctgcgctcacaagagcgg
acaccacaccacctcacctccacgctgaccggagccatgccatga

DBGET integrated database retrieval system