KEGG   Streptomyces bingchenggensis: SBI_01708Help
Entry
SBI_01708         CDS       T01678                                 

Definition
putative pectinesterase A
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:sbh00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sbh00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2298734..2299801
Genome map
AA seq 355 aa AA seqDB search
MSTTDRRPRRRLTGPLVSAPLALATGAVLVAAGAPAAQAEAAATIVVAKDGSGNYTTVQA
AVDAVPANNTSAVTISVKPGTYRETVKIPSNKPHVRLVGATSSKNDVTIVYNNASGTPKP
GGGTYGTSGSATFAVEADDFQARNLQFVNDFNEANTSITDKQAVALRTAGDKIVLDNIGA
LGDQDTLLLDSASKDKVGRVYVNNAWIQGNVDFIFGRASAVITKSTIRLVKRYDGSSAGY
VAAPSTAAGKHGFLIINSNVTGDVSDRSHYLGRPWHAGGDASLDPQAIVRNTSLSAAVRT
TPWTDMSGFSWKDDRFAEYKNTGAGSGSASTDRPQLSDSQAADYEIADWLGDWTP
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgtccacaacggaccggcgcccccggcggcgcctcactggaccgctcgtcagcgcccct
ctcgccctggccacaggtgccgtgctggtcgccgcaggcgcaccggcggcgcaggccgag
gccgcggcgacgatcgtcgtcgcgaaggacggcagcggcaactacaccaccgtgcaggcc
gcggtcgacgcggtgccggcgaacaacacctccgccgtcaccatctccgtcaagcccggc
acgtaccgcgagaccgtgaagatccccagcaacaagccgcacgtccggctggtgggcgcc
accagcagcaagaacgacgtgaccatcgtctacaacaacgcctcgggcacccccaagccc
ggcggcgggacctacggcaccagcggcagcgcgacgttcgccgtcgaggcagacgacttc
caggcccgcaatctgcagttcgtcaacgacttcaacgaggcgaacaccagcatcaccgac
aagcaggcggtggcgctgcgcaccgcgggcgacaagatcgtcctggacaacatcggggcc
ctgggcgaccaggacaccctgctgctggactcggcaagcaaggacaaggtcggccgggtg
tacgtcaacaacgcctggatccagggcaatgtcgacttcatcttcggccgcgcctccgcc
gtgatcaccaagtccacgatacggctggtcaagcggtacgacggcagctcggccgggtac
gtggccgcgccctcgaccgcggccggcaaacacggcttcctgatcatcaacagcaacgtc
accggcgatgtcagcgaccgcagccactacctcggccgcccctggcacgcgggcggcgac
gcgagcctggatccgcaggccatcgtccgcaacacctccctgagcgccgcggtccggacc
accccgtggaccgatatgagcggcttctcctggaaggacgaccggttcgccgagtacaag
aacaccggggcgggttcggggtcggcgagcaccgaccgtcctcagctcagcgactcccag
gccgcggactacgagatcgcggactggctgggcgactggacgccctga

DBGET integrated database retrieval system