KEGG   Streptomyces bingchenggensis: SBI_01731Help
Entry
SBI_01731         CDS       T01678                                 

Gene name
echA3
Definition
enoyl-CoA hydratase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SBI_01731 (echA3)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SBI_01731 (echA3)
   00650 Butanoate metabolism
    SBI_01731 (echA3)
  Lipid metabolism
   00071 Fatty acid degradation
    SBI_01731 (echA3)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SBI_01731 (echA3)
   00310 Lysine degradation
    SBI_01731 (echA3)
   00360 Phenylalanine metabolism
    SBI_01731 (echA3)
   00380 Tryptophan metabolism
    SBI_01731 (echA3)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SBI_01731 (echA3)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SBI_01731 (echA3)
   00281 Geraniol degradation
    SBI_01731 (echA3)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SBI_01731 (echA3)
   00627 Aminobenzoate degradation
    SBI_01731 (echA3)
   00930 Caprolactam degradation
    SBI_01731 (echA3)
Enzymes [BR:sbh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SBI_01731 (echA3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2325445..2326221
Genome map
AA seq 258 aa AA seqDB search
MGVSTSAPHAGVAVVTVDFPPVNALPVQGWYELASAVRGAGRDPDVRCVVLAAAGRGFNA
GVDIKEMQRTEGHQALIGANHGCYEAFAAVYDCQVPVVAAVHGFCLGGGIGLVGNADAIV
ASDDATFGLPELDRGALGAATHLARLVPQHLMRALYYTSRTVTAEELHRHGSVWRVVPRA
ELSDAALELAREIAAKDGALLRLAKAAINGIDPVDVRRSYRFEQGFTFEANLSGIADRHR
EAFVSGPSGLSAEAGERR
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgggtgtctccacctccgccccacacgcgggcgtcgccgtcgtcaccgtggacttccca
ccggtcaacgcccttcccgtccagggctggtacgagctcgcgtccgccgtgcgcggcgca
ggcagagaccctgatgtgcgctgtgtcgtcctcgccgccgccgggcggggcttcaacgcg
ggcgtggacatcaaggagatgcagcgcaccgaggggcatcaggccctgatcggcgccaac
cacggctgctacgaggcgttcgccgccgtctacgactgccaggtcccggtcgtcgccgcg
gtgcacggcttctgcctcggcggcggcatcggcctggtcggcaacgccgacgcgatcgtg
gcgagcgacgatgcgacgttcgggctgccggagctggaccggggcgccctgggcgcggcc
acccatctggcccggctggtgccacagcacctgatgcgcgcgctgtactacacctcgcgc
accgtgaccgccgaggagctgcaccggcacggctcggtgtggcgggtcgtaccgcgcgcg
gagctgtcggacgcggcgctggagctggcccgcgagatcgccgccaaggacggggcgctg
ctgcggctggccaaggccgcgatcaacggcatcgacccggtcgatgtgcgccgcagctac
cgcttcgaacagggcttcaccttcgaggccaacctgagcggcatcgccgaccggcaccgg
gaggcgttcgtgtccggcccctctggcctttctgctgaggcgggtgagcggcgttga

DBGET integrated database retrieval system