KEGG   Streptomyces bingchenggensis: SBI_02098Help
Entry
SBI_02098         CDS       T01678                                 

Definition
secreted alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sbh00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sbh00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:sbh00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2856206..2857453
Genome map
AA seq 415 aa AA seqDB search
MRSKEMIMQGNVRSGGLRSLVAVATATATTAAAAITFTLTAGAGQAAALDNGLLRTPPMG
FNNWNATHCDSSFNESMVKGVADAFVSLGLKDVGYEYVNIDDCWAETSRDSDGNLVPDRT
RFPNGIKAVADYVHSKGLKFGIYTSAGTKTCNSAGFPGGLNHEKQDAKQFASWGVDYLKY
DNCNNQGVDAQQRYKAMRDALAASGRKIAYSICEWGQTSPKVWTWGEPVGNLWRTTGDIS
DKWSSMIDKVHINDDLAQYAGPGHWNDPDMLEVGNGGMTATEYRTHFSLWAMMAAPLLIG
SDIRDASATTQSILKNTDLIAVDQDTLGKQATIVSSSGGKVVYTKQLANGDRAVALLNEN
SSAKTISTTATAIGLGGSSSYGLKDLWSKATSTTTGSISASVPAHGTVVFRVSRG
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atgcgttcgaaggagatgatcatgcaaggaaacgtacgatccggcggactccgctcattg
gtcgcggtggccaccgccaccgccaccaccgcggcagccgccatcaccttcacgctcacc
gccggggccggtcaggccgccgcgctggacaacggcctgctccgcacgccccccatgggc
ttcaacaactggaacgccacgcactgcgactcctcgttcaacgagtccatggtcaagggg
gtcgccgacgccttcgtctcgctcggcctcaaggacgtcggctacgagtacgtcaacatc
gacgactgctgggcggagaccagccgggactcggacggcaatctggtgcccgaccgcacc
cgcttcccgaacggcatcaaggccgtggcggactatgtgcactccaaggggctcaagttc
ggcatctacaccagcgccggcaccaagacctgcaacagcgccggcttccccggggggctg
aaccacgagaagcaggacgccaagcagttcgcgtcctggggcgtggactacctcaagtac
gacaactgcaataaccagggcgtggacgcccagcagcgctacaaggccatgcgcgacgcg
ctcgcggccagcgggcggaagatcgcgtacagcatctgcgaatggggccagaccagcccc
aaggtgtggacctggggcgagccggtcggcaatctttggcggaccaccggcgacatcagc
gacaagtggtccagcatgatcgacaaggtgcatatcaacgacgacctcgcgcagtacgcg
ggcccgggccactggaacgacccggacatgctggaggtcggcaacggcgggatgaccgcc
accgagtaccgcacccacttcagcctctgggcgatgatggcggcgccgctgctcatcggc
agcgatatccgcgacgcctccgccaccacccagtcgatcctgaagaacaccgacctgatc
gcggtggaccaggacaccctgggcaagcaggcgaccatcgtgtcctccagcggcggcaag
gtcgtgtacaccaagcaactggccaacggcgaccgggcggtcgccctgctcaacgagaac
tcgtccgccaagacgatctccaccacggccaccgcgatcggcctcggcggctcgtcctcg
tacgggctcaaggacctgtggtccaaggcgaccagcaccacgaccggttcgatcagcgcc
tcggtgcccgcgcacggcacggtggtgttccgggtctcgcgcggctga

DBGET integrated database retrieval system