KEGG   Streptomyces bingchenggensis: SBI_02673Help
Entry
SBI_02673         CDS       T01678                                 

Definition
asparagine synthetase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SBI_02673
Enzymes [BR:sbh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     SBI_02673
Peptidases [BR:sbh01002]
 Cysteine Peptidases
  Family C44
   SBI_02673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3532413..3534251
Genome map
AA seq 612 aa AA seqDB search
MLMDMWWMILPDTEAAAALADRLGVRDLDLLRHASGRPWLLGRWRGAEVVTAEAGDVRVA
VLGRCLLTAEALRTRIARVRDVREVADAVGRVAGSYHVVATVGGRVWARGTASAACRLFT
ARVEGVPVAAPGADVLAGLLDSGPDQEMLAARLMDPPLSSTALGGRTLWRQVWAVRPDEA
LVWERNGAQRTVRWWHPPEPGLGLRTAAEEVRAALVEAVATCTAGGGTVSADLSGGLDST
SLCFLAAARGEAGLVTLRWEGVDAQNDDAFWARRAVAALPDATHLVVTERETPDWFAGVD
GMRLATEEPVAWARDVAKQSDVLERVAAHGSRLHLCGGGGDELFTPSPAHLTDLVWSHPM
LVLRRLRLLRFDWRVGRTAALRAVCDRGGYQRWLYRAARDLVSPPPNPLLGRLDWQPPPR
MPAWATPEAVRAVAAVLKEAADRCPEPLAPQRSLHTVLLQVREGGNAIRQMNKAFPGPGY
AMPYTDDAVVAAALSVRPLEAGVPGRFKPLLTEAMDGIVPRAILRRTSKGRYGADFHRGL
RRRRGEVLALLDGSLLAEAGLIDTERLRRALHTHAPASEPAFLMHTVAGEIWLRSVAQGP
HPRTVQLTGGAR
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
gtgctcatggacatgtggtggatgatcctgccggatacggaggccgcggccgccttggcg
gatcggctcggtgtgcgggatctggacctgctgcggcacgcctcggggcggccgtggctg
ctgggccggtggcgtggcgcggaggtggtgacggccgaggcgggtgatgtgcgggtggcg
gtgttgggccggtgcctgctgaccgcggaggccctgcggacgcggatcgcgcgcgttcgg
gatgtacgggaggtggcggacgcggtcggccgggtggcgggcagctaccacgtggtggcc
acggtcggcggccgggtgtgggcgcgcggcaccgcctcggcggcatgccggctgttcacc
gcccgtgtggagggtgtgccggtggcggcaccgggggccgatgtactggccgggctgctc
gactcgggcccggaccaggagatgctggccgcacgcttgatggaccctcccctctcgtcg
acggcgctgggcgggcgcaccctgtggcggcaggtgtgggcggtgcggcccgatgaggcg
ctggtgtgggagcggaacggggctcagcgcaccgtgcggtggtggcatccgcccgagccg
gggctcgggttgcgtacggcggccgaggaggtgcgcgccgcgctggtcgaggcggtggcc
acctgcacggctggtgggggcacggtcagcgcggatctgtcgggcgggctggactcgacc
agcctgtgctttctcgccgccgcccggggcgaggccgggttggtgacgctgcgctgggag
ggcgtggacgcgcagaacgacgacgccttctgggcccggcgggcggtcgcggcgctgccg
gacgccacccatctggtggtgacggagcgcgagaccccggactggttcgccggtgtggac
gggatgcgcctggccacggaggaaccggtggcgtgggcgcgggatgtggcgaagcagagc
gatgtcctcgagcgggtggcggcgcacggctctcggctgcatctgtgcggaggcggcggc
gacgagttgttcaccccgtcgccggcacacctgaccgacctggtgtggtcgcatccgatg
ctggtgctgcggcgtctgcgccttctgcgcttcgactggcgggtgggccgtacggcggcg
ctgcgcgcggtatgcgaccggggcggctaccagcggtggctgtaccgggcggcccgcgat
ctggtctcgccgccgccgaacccgctgctgggccggctggactggcagccgccgccccgt
atgcccgcgtgggccacccccgaggcggtacgcgccgtcgcggccgtgctcaaggaagcc
gctgaccgctgccccgaaccactggccccgcagcgttccctgcacaccgtgctcctgcaa
gtgcgcgagggtggcaacgcgatccgccagatgaacaaggctttccccggccccggttac
gccatgccctacaccgacgacgcggtggtggccgccgccctgtccgtacgccctctggag
gccggtgtcccgggccgcttcaaaccgctgctgaccgaggcgatggacggcatcgtgccg
cgcgcaatcctgcgccgcacctcaaagggccgctacggcgccgacttccaccgcgggctg
cgccgccggcgcggcgaggtcctggccctcctggacggttcactgctggccgaggccgga
ctgatcgatacggaacggctgcggcgcgccctgcacacgcacgccccggcgtccgagccg
gccttcctgatgcacaccgtggccggggagatctggctgcgctcggtggcccaggggccg
cacccacggaccgtacaactcacgggaggcgcccgttga

DBGET integrated database retrieval system