KEGG   Streptomyces bingchenggensis: SBI_02681Help
Entry
SBI_02681         CDS       T01678                                 

Definition
putative UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    SBI_02681
   00052 Galactose metabolism
    SBI_02681
   00500 Starch and sucrose metabolism
    SBI_02681
   00520 Amino sugar and nucleotide sugar metabolism
    SBI_02681
Enzymes [BR:sbh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     SBI_02681
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3538414..3539343
Genome map
AA seq 309 aa AA seqDB search
MSLTIRRAVIPAAGLGSRLLPLTKATPKEMLPVGDKPVIEHTVRELVDSGITDITIVVSG
GKSLIQDHFRPNPALVEQLREDGKTAYADAVEEVAELARRGHITYLDQYGPYGNGTPVLN
AARAFGDEPVLVLWPDDVFVAEVPRAQQLIRAYEQTGCPVLALMPMDPNESQRYGVPIVK
EDLGDGQLRITGLVEKPTPAAAPSSYAAIGGYVVTPGIIDELREQTRRWYEHKTGEVYLT
DAINAYASTRAVYGQVIKGRWYDTGNPADYLVAQMASALAHPEYGPVLRGLVAGLDVDRD
AALRSETNT
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgacgattcgcagggccgtgatccccgccgccggactcggctcccgtctgctg
cccctgacgaaggcgacaccgaaggagatgctcccggtcggcgacaagccggtcatcgag
cacaccgtgcgcgaactggtggactccggcatcaccgacatcaccatcgtcgtctccggc
ggcaagagccttatccaggaccacttccgccccaaccccgccctcgtcgaacaactccgc
gaagacggcaagacggcctacgcggacgcggtggaggaggtcgcggagctggcccgccgg
ggccacatcacctacctcgaccagtacggcccgtacggcaacggcaccccggtgctgaac
gctgcccgtgccttcggcgacgagccggtgctggtgctgtggcccgacgacgtcttcgtg
gccgaggtcccccgcgcccagcagttgatccgcgcgtatgagcagaccggctgcccggtg
ctggccctcatgccgatggaccccaacgagtcccagcgctatggcgtgcccatcgtcaag
gaagacctcggagatggccaactgcgcatcaccggcctggtcgaaaagcccacgcccgct
gccgccccgtcctcgtacgcggcgatcggcggctatgtcgtcacccctggcatcatcgac
gaactgcgtgagcagacccgccgctggtacgagcacaagaccggcgaggtctacctgacc
gacgccatcaacgcctacgcctccacccgcgcggtgtacgggcaggtcatcaagggccgc
tggtacgacaccggcaacccggccgactacctggtcgcccagatggcgtccgccctcgcc
cacccggagtacggccccgtcctacgcggcctggtcgccggactcgacgtcgaccgcgat
gccgccctccggtcggaaaccaacacctga

DBGET integrated database retrieval system