KEGG   Streptomyces bingchenggensis: SBI_02941Help
Entry
SBI_02941         CDS       T01678                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:sbh01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sbh00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:sbh00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3844509..3846125
Genome map
AA seq 538 aa AA seqDB search
MSAPAPSPLAIVDAEPLERQGEVLTDSALAFLAELHHRFTPRRDELLARRAERRAEIART
GTLDFLPQTAHVREDPDWCVAPAPAALDDRRVEITGPTDRKMTINALNSGAKVWLADFED
ASAPTWENVVHGQLNLIDAYQRRIDFTTPEGKSYALRPAEELATVVARPRGWHLDERHLR
AGDRAVPGALVDFGLYFFHNAQRLLDQGKGPYFYLPKTESHLEARLWNDIFVFAQDHLGI
PQGTIRATVLIETITAAYEMEEILYELRDHASGLNAGRWDYLFSIVKNFRDAGADFVLPD
RNAVTMTAPFMRAYTELLVRTCHKRGAHAIGGMAAFIPSRRDPEVNAVAFEKVRADKDRE
ANDGFDGSWVAHPDLVPIARASFDAVLGDKPNQKDRLREDVQVTAAELINIASLDAKPTS
AGLRNAVQVGIRYIEAWLRGLGAVAIFNLMEDAATAEISRSQIWQWINAGVVFENGEKAT
AGLVRTIAAEELTAIREEIGAEAFAAGNWQQAHDLLLKVALDEDYAEFLTLPAYELLR
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcaccagcaccgtccccgctggccatcgtcgacgccgagccgctggaacggcag
ggagaggtgctgaccgactcggccctggccttcctggccgagctccaccaccgcttcacc
ccgcgccgcgacgaactgctcgcccgccgcgccgaacgccgcgccgagatcgcccgaacc
ggcacccttgacttcctcccgcagaccgcccacgtccgcgaggaccccgactggtgcgtc
gcccccgccccggccgcgctcgacgaccgccgggtggagatcaccggccccaccgaccgg
aagatgaccatcaacgccctcaactcgggcgccaaggtctggctcgccgacttcgaggac
gcctccgcgccgacctgggagaacgtcgtccacggccagctcaacctcatcgacgcctac
cagcgccgtatcgacttcaccacccccgagggcaagtcgtacgccctgcgccccgccgaa
gagctcgccaccgtcgtcgcccggccgcgcggctggcatctggacgagcgccatctgcgg
gccggcgaccgcgccgtgcccggcgccctcgtcgacttcgggctctacttcttccacaac
gcccagcgcctgctcgaccagggcaagggcccgtacttctacctccccaagaccgagtcg
cacctcgaggcccgcctctggaacgacatcttcgtcttcgcccaggaccacctcggcatc
ccccagggcaccatccgcgccaccgtgctcatcgagacgatcaccgccgcgtacgagatg
gaggagatcctctacgagctgcgcgaccacgcctccgggctgaacgcggggcgctgggac
tacctcttctccatcgtcaagaacttccgtgacgccggggccgacttcgtcctccccgac
cgcaacgccgtcaccatgaccgcccccttcatgcgcgcctacaccgagctgctggtgcgc
acctgccacaagcgcggcgcccacgcgatcggcggcatggcggccttcatcccctcccgc
cgcgaccccgaggtcaacgccgtcgcgttcgagaaggtcagggccgacaaggaccgcgag
gcgaacgacggcttcgacggctcctgggtcgcccaccccgacctggttccgatcgcccgc
gcctcgttcgacgcggtgctcggcgacaagccgaaccagaaggaccggctgcgcgaggac
gtccaggtcaccgcggccgagctgatcaacatcgcctccctggacgccaagcccacctcg
gcggggctgcgcaatgcggtccaggtcggtatccgctatatcgaggcctggctgcggggc
ctgggcgcggtcgccatcttcaacctgatggaggacgccgccacggccgagatctcccgc
tcccagatctggcagtggatcaacgcgggcgtcgtcttcgagaacggcgagaaggcgacg
gccggtctcgttcgcaccatcgcggcggaggagctgacggcgatccgcgaggagatcggg
gcggaggcgttcgccgcgggcaactggcagcaggcccacgatctgctgctcaaggtcgcg
ctggacgaggactacgcggagttcctgacgctgccggcgtacgagctgctgcgctga

DBGET integrated database retrieval system