KEGG   Streptomyces bingchenggensis: SBI_02941Help
Entry
SBI_02941         CDS       T01678                                 

Definition
malate synthase
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SBI_02941
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SBI_02941
   00630 Glyoxylate and dicarboxylate metabolism
    SBI_02941
Enzymes [BR:sbh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SBI_02941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3844509..3846125
Genome map
AA seq 538 aa AA seqDB search
MSAPAPSPLAIVDAEPLERQGEVLTDSALAFLAELHHRFTPRRDELLARRAERRAEIART
GTLDFLPQTAHVREDPDWCVAPAPAALDDRRVEITGPTDRKMTINALNSGAKVWLADFED
ASAPTWENVVHGQLNLIDAYQRRIDFTTPEGKSYALRPAEELATVVARPRGWHLDERHLR
AGDRAVPGALVDFGLYFFHNAQRLLDQGKGPYFYLPKTESHLEARLWNDIFVFAQDHLGI
PQGTIRATVLIETITAAYEMEEILYELRDHASGLNAGRWDYLFSIVKNFRDAGADFVLPD
RNAVTMTAPFMRAYTELLVRTCHKRGAHAIGGMAAFIPSRRDPEVNAVAFEKVRADKDRE
ANDGFDGSWVAHPDLVPIARASFDAVLGDKPNQKDRLREDVQVTAAELINIASLDAKPTS
AGLRNAVQVGIRYIEAWLRGLGAVAIFNLMEDAATAEISRSQIWQWINAGVVFENGEKAT
AGLVRTIAAEELTAIREEIGAEAFAAGNWQQAHDLLLKVALDEDYAEFLTLPAYELLR
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcaccagcaccgtccccgctggccatcgtcgacgccgagccgctggaacggcag
ggagaggtgctgaccgactcggccctggccttcctggccgagctccaccaccgcttcacc
ccgcgccgcgacgaactgctcgcccgccgcgccgaacgccgcgccgagatcgcccgaacc
ggcacccttgacttcctcccgcagaccgcccacgtccgcgaggaccccgactggtgcgtc
gcccccgccccggccgcgctcgacgaccgccgggtggagatcaccggccccaccgaccgg
aagatgaccatcaacgccctcaactcgggcgccaaggtctggctcgccgacttcgaggac
gcctccgcgccgacctgggagaacgtcgtccacggccagctcaacctcatcgacgcctac
cagcgccgtatcgacttcaccacccccgagggcaagtcgtacgccctgcgccccgccgaa
gagctcgccaccgtcgtcgcccggccgcgcggctggcatctggacgagcgccatctgcgg
gccggcgaccgcgccgtgcccggcgccctcgtcgacttcgggctctacttcttccacaac
gcccagcgcctgctcgaccagggcaagggcccgtacttctacctccccaagaccgagtcg
cacctcgaggcccgcctctggaacgacatcttcgtcttcgcccaggaccacctcggcatc
ccccagggcaccatccgcgccaccgtgctcatcgagacgatcaccgccgcgtacgagatg
gaggagatcctctacgagctgcgcgaccacgcctccgggctgaacgcggggcgctgggac
tacctcttctccatcgtcaagaacttccgtgacgccggggccgacttcgtcctccccgac
cgcaacgccgtcaccatgaccgcccccttcatgcgcgcctacaccgagctgctggtgcgc
acctgccacaagcgcggcgcccacgcgatcggcggcatggcggccttcatcccctcccgc
cgcgaccccgaggtcaacgccgtcgcgttcgagaaggtcagggccgacaaggaccgcgag
gcgaacgacggcttcgacggctcctgggtcgcccaccccgacctggttccgatcgcccgc
gcctcgttcgacgcggtgctcggcgacaagccgaaccagaaggaccggctgcgcgaggac
gtccaggtcaccgcggccgagctgatcaacatcgcctccctggacgccaagcccacctcg
gcggggctgcgcaatgcggtccaggtcggtatccgctatatcgaggcctggctgcggggc
ctgggcgcggtcgccatcttcaacctgatggaggacgccgccacggccgagatctcccgc
tcccagatctggcagtggatcaacgcgggcgtcgtcttcgagaacggcgagaaggcgacg
gccggtctcgttcgcaccatcgcggcggaggagctgacggcgatccgcgaggagatcggg
gcggaggcgttcgccgcgggcaactggcagcaggcccacgatctgctgctcaaggtcgcg
ctggacgaggactacgcggagttcctgacgctgccggcgtacgagctgctgcgctga

DBGET integrated database retrieval system