KEGG   Streptomyces bingchenggensis: SBI_03195Help
Entry
SBI_03195         CDS       T01678                                 

Definition
UDP-N-acetylglucosamine transferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SBI_03195
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SBI_03195
Enzymes [BR:sbh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     SBI_03195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4172700..4174229
Genome map
AA seq 509 aa AA seqDB search
MTDDYLSRIGKLIRDARQHRGWTQAQLAEALNTSQSAVNRIERGNQNISLEMIARIGEAL
DSEIVSLGYAGPMHLRVVGGRRLSGAIDVKTSKNACVALLCATLLNSGRTTLRRVARIEE
VYRILEVLGSIGVRTRWINDGADLEIVPPAELDLDSMDTEAARRTRSVIMFLGPLLHRMR
QFKIPYAGGCDLGTRTVQPHMTALRPFGLEVTATDGMYHARVDREVSPTRAIVLTERGDT
VTENALLAAARHDGVTVIRNASPNYMVQDLCFFLEELGVKVEGIGTTTLTVHGLADIDRD
VDFAPSEDPVEAMSLLAAAVVTESELTIRRVPVEFLEIELAVLEEMGLDHERSAEYAADN
GRTRLIDLTVRPSKLQAPIDKIHPMPFPGVNIDNVPFFAAIAASAQGSTLIHDWVYDNRA
IYLTELNRLGAHVKLLDPHRVLVEGPTRWRAAEMMCPPALRPAVVVLLAMMAAPGTSVLR
NVYVINRGYEDLAERLNSIGAQIEIFRDI
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgactgacgactacctctcccgtatcggcaagctcatccgcgacgcccgccagcatcgc
ggctggacccaagcgcagctcgcggaagcgctcaacaccagccagagcgcggtcaatcgc
atcgagcgaggcaaccagaacatcagtcttgagatgattgccaggatcggcgaggcactt
gacagcgagatcgtctcgctcggatacgcggggccgatgcatctgcgggtcgtcggcggc
cggcgcctctcgggcgccatcgacgtcaagacgagcaagaacgcatgcgtcgcgctgctg
tgcgccacgctgctcaactcgggccgtacgaccctgcggagggtcgcccggatcgaggag
gtctaccgcatcctggaggtgctgggcagcatcggcgtccgcacccgctggatcaacgac
ggggccgatctggagatcgtgccgcccgccgaactggacctcgactccatggacaccgag
gccgcccgccgcacccgcagcgtcatcatgttcctcggcccgctgctgcaccgtatgcgg
cagttcaagatcccgtacgcgggcggctgcgacctcggcacccgcaccgtgcagccgcat
atgaccgcgctgcgccccttcggcctcgaagtgaccgccacggacgggatgtaccacgca
cgggtggaccgcgaggtgtcccccacccgcgcgatcgtgctgaccgagcgcggcgacacc
gtcaccgagaacgcgctgctggccgcggcccggcacgacggcgtcaccgtgatccgcaac
gcctcccccaactacatggtccaggatctgtgcttcttcctggaggagttgggggtcaag
gtcgaaggaatagggaccaccacactcaccgtgcacggcctcgccgatatcgaccgggac
gtggacttcgccccgtccgaggacccggtcgaggcgatgagcctgctggccgccgcggtg
gtgacagagtcggagctgacgatccggcgggtgccggtggagttcctggagatcgagctg
gccgtgctggaggagatgggcctcgaccacgagcgcagcgccgagtacgcggcggacaac
ggccgtacgcggctgatcgacctgaccgtacggccctccaagctccaggcgcccatcgac
aagatccacccgatgccgttccccggcgtcaacatcgacaacgtgcccttctttgcggcc
atcgccgcgtccgcgcagggctccacgctgatccacgactgggtctacgacaaccgggcc
atctacctcaccgagttgaaccgcctcggcgcccacgtcaagctcctcgacccgcaccgg
gtgctggtcgagggcccgacccggtggcgggcggccgagatgatgtgcccgccggcgctg
cgccccgcggtggtggtgctgctggcgatgatggcggcgccggggacgtcggtgctgcgc
aatgtgtatgtgatcaaccggggttatgaagacctggcggagcggctgaactcgatcggc
gcgcagatcgagatcttccgggacatctga

DBGET integrated database retrieval system