KEGG   Streptomyces bingchenggensis: SBI_03421Help
Entry
SBI_03421         CDS       T01678                                 

Gene name
bga10
Definition
beta-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    SBI_03421 (bga10)
Enzymes [BR:sbh01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SBI_03421 (bga10)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4455798..4457849)
Genome map
AA seq 683 aa AA seqDB search
MPELSDVTRGRILYGGDYNPEQWPRSVWREDVRLMREARVTTATVGVFSWARLEPRPGAR
DFGWLDEVLDLLHEGGIEVCLATPTASPPPWMGARHPETLPRDESGATVWYGARNQFCAS
SPIYCEYALRITEDLAERYGGHPAVRMWHVGNEYGTHCWCDTTARHFRRWLRTRYGGLDA
LNEAWGTAFWSQRYDSWEEIIPPRRAQYLVNPTQALDFRRFTSDALLECFTTERDVLADR
TPHAPVTTNFMPLFIGQDGWAWAAEEDVVSVDVYPDPKDPHAAAYGAMVQDLTRSQAGGP
WVLMEQAAGPVNWRGVNHPKPPGLMRLWSLQAVARGADVVCFFQWRQSRQGSEKFHSGMV
PHAGEHSRTFQQVRGLGAELRRLGGVVGRGVPAGAAILHDWHAWWATVQDGRPSARLDYP
QVVRAWHRALWEQNLTTDFAHPHADLTDYALVAVPQLYLLTDEALDNLVGYVRGGGTLVC
GFFTGVADEDDRVRPGGVDQRLRDLLGIRTVHEWWPLDEGETVTAHGPSWPAGFTATLWS
EDLEPSTAETVARIKGGELDGGPAITRNRHGAGTAWYVSTLPEPAALRALPARAADEAGL
RPPLPGLPEGVEAVFRGEHLFLLNHGRTPAVVPLPSARTDLLTGRVYDTEVGLDRSAAVV
LAPLDSPHPKGAAPCTERLESSS
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgcccgagctgagcgatgtcacccgcggccgcatcctctacggcggcgactacaacccc
gagcagtggccgcggagcgtctggcgcgaggacgtacggctgatgcgcgaggcccgggtc
accaccgccaccgtcggggtcttctcctgggcccggctggaaccgcgccccggcgcccgc
gacttcggctggctggacgaggtcctggacctgctccacgagggcggtatcgaggtgtgc
ctggccaccccgaccgcctccccgcccccgtggatgggcgcccgccaccccgagaccctg
ccgcgcgacgagtcaggcgccaccgtctggtacggcgcgcgcaaccagttctgcgcctcc
tcccccatctactgcgagtacgcgctgcgcatcaccgaggacctggcggagcgctacggc
ggccacccggcggtgcgcatgtggcacgtcggcaacgaatacggcacccactgctggtgc
gacaccaccgcccgccacttccgccgctggctgcgcacccggtacggcggtctcgacgcg
ctcaacgaggcgtggggcacggccttctggagccagcgctacgactcgtgggaggagatc
attccgccccgccgcgcccagtatctggtcaaccccacccaggcgctggacttccgccgc
ttcaccagcgacgccctgctggagtgcttcaccaccgaacgcgacgtcctggccgaccgc
accccgcacgcccccgtcaccaccaacttcatgccgctgttcatcggccaggacggctgg
gcgtgggcggccgaggaggacgtggtctccgtcgacgtctacccggaccccaaggacccg
cacgccgccgcgtacggggcgatggtccaggacctcacccgctcccaggccggcggcccc
tgggtcctcatggagcaggcggccggcccggtcaactggcgtggcgtcaaccaccccaag
ccgcccgggctgatgcgcctgtggtcgctgcaggccgtggcgcgcggcgcggacgtcgtc
tgcttcttccagtggcggcagtcgcggcagggcagcgagaagttccactccgggatggtg
ccgcacgccggtgagcacagccgtaccttccagcaggtgcgcgggctcggcgccgaactg
cgccggctcggcggcgtcgtcggccgcggcgtccccgcaggcgccgcgatcctgcacgac
tggcacgcctggtgggcgaccgtccaggacggccgcccctccgcccgcctcgactacccc
caggtggtgcgcgcctggcaccgggccctgtgggagcagaacctcaccaccgacttcgcc
catccgcacgccgacctcaccgactacgccctggtcgccgtcccccagctgtatctgctc
accgacgaggcgctggacaatctggtcggctacgtacgcggtggcggcaccctggtctgc
ggcttcttcaccggcgtcgccgacgaggacgaccgggtccgcccgggcggcgtcgaccag
cggctccgcgaccttctcggcatccgtacggtccacgagtggtggccgctggacgagggc
gaaaccgtcaccgcccacggcccctcctggcccgccggcttcaccgccaccctctggtcc
gaggacctggagccgtccaccgccgagaccgtcgcccggatcaagggcggcgaactcgac
ggcgggcccgccatcacccgcaaccgccacggcgccggcaccgcctggtacgtctccacc
ctgcccgaacccgccgcgctgcgcgccctgccggcccgcgccgccgacgaggcggggctg
cggccaccgctgcccggcctccccgagggcgtggaggccgtgttccgcggcgagcacctg
ttcctcctcaaccacggccgcacccccgcggtcgtccccctcccgtccgcgcggaccgac
ctgctcaccggccgcgtgtacgacaccgaggtcggcctcgaccgctccgcggccgtggtc
ctggccccgctcgattccccccacccgaagggagcagcaccgtgcaccgaaaggctcgaa
agctcttcctga

DBGET integrated database retrieval system