KEGG   Streptomyces bingchenggensis: SBI_03541Help
Entry
SBI_03541         CDS       T01678                                 

Definition
glycoside hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sbh00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4590739..4591692
Genome map
AA seq 317 aa AA seqDB search
MRLPRAFVTAALATAFLVGAGHAPQAVAGELPGGTTFFTDSQSQVNKWVAANPSDSRQPR
IASRIGSQPQAVWFANYSPSTVTADVRRVTAAAAGKNQVPVLVAYMIPNRDCGGASAGGA
PDLAAYDAWARNFAAGLGSGSSIVILEPDSIALITCLSSSELSGRYASLARAASAIHAAN
PKARVYFDAGHSAWNSAATQASRLRSAGVLTSGDGIYSNVSNYNRTANEVAFAKSVLSQL
GGSGLTAVIDTSRNGNGPAPDNAWCDPHGRKLGENPTANTGDPAIDAYLWIKLPGELDGC
AGAAGSFSPDYAYELAG
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcctcccccgagcgtttgtgaccgccgctctcgccaccgcgttcctggtgggggcg
ggccatgcgccccaagccgtcgcgggtgaactgcccggcggcaccacgttcttcaccgac
tcccagtcccaggtcaacaagtgggtcgccgccaaccccagcgattcgcgccagccgcgc
atagcctcgcgcataggcagccagccgcaggccgtctggttcgccaactactccccctcc
accgtcaccgcggacgtccgcagggtgaccgccgcggccgccggcaagaaccaggtcccc
gtcctcgtcgcgtatatgatccccaaccgtgactgcggcggcgcctccgcgggcggcgcc
cccgacctcgccgcctacgacgcctgggcgcgcaacttcgccgccggactgggcagcggg
tcctcgatcgtcatcctcgaaccggactcgatcgcgctcatcacctgcctgtcctccagc
gagctgagcggccgctacgcctcgctcgcccgggccgcgagcgccatccacgccgcgaac
cccaaagcccgggtctacttcgacgccggccactccgcctggaacagcgccgccacgcag
gcctcgcggctgcgctcggcgggcgtgctgaccagcggcgacggcatctacagcaatgtc
tccaactacaaccgcaccgccaacgaggtcgccttcgccaagagcgtgctcagccagctc
ggaggctcgggcctgaccgcggtcatcgacaccagccgcaacggcaacggccccgccccc
gacaacgcctggtgcgacccgcacggccgcaagctgggcgagaacccgacggcgaacacc
ggcgacccggccatcgacgcctatctgtggatcaagctgccgggcgaactggacggctgc
gcgggcgccgcgggcagcttctccccggactacgcgtacgagctggcgggctaa

DBGET integrated database retrieval system