KEGG   Streptomyces bingchenggensis: SBI_03688Help
Entry
SBI_03688         CDS       T01678                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SBI_03688
Enzymes [BR:sbh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SBI_03688
Exosome [BR:sbh04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SBI_03688
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4766821..4769046
Genome map
AA seq 741 aa AA seqDB search
MLAAAPLGDTDRERLLSGSHHDPHALLGAHPVRGGILFRALRPYARSVAVTATGLRAQLR
PEGDGLFSGVLPLRGIPDYRLLVEYENGQYETGQTAQTAQTPQHDPYRFLPALGELDLHL
IGEGRHEELWRALGTHPMTHHGVAGTRFTVWAPDARGVRVAGDFNYWDGTAAPMRSLGGS
GVWELFLPGVGDGAVYKFDITRPDGSHTLRADPMARHTECPPATASIVHTSHHEWRDAEW
LARRAGQCVHESPFSVYEVHLPSWRPGLTYRQLAEQLPAYVKDLGFTHVELMPVAEHPFG
GSWGYQVTGFYAPTARLGTPDDFKYLVDALHRAGIGVLVDWVPAHFPRDEWALAEFDGRP
LYEPADPARAAHPDWGTLEFDYGRTEVRNFLVANAVYWCEEFHVDGLRVDAVASMLYLDY
SREPGQWTPNAHGGRENLDAVAFLQEMNATVYRRCPGVLTIAEESTAWDGVTRATHHVGP
SGFGGLGFGLKWNMGWMHDSLGYVGHEPVHRKYHHHEMTFSMVYAYSENYVLPISHDEVV
HGKRSLVSKMPGDWWQRRADHRAYLGFMWAHPGKQLLFMGQEFAQGAEWSESHGPDWWLL
DPSYSAEPDHRGVRDLVRELNQVYLATPALWQRDTVPEGFAWVEGDAREDNVFAFLRFAA
DGSPLLAISNFSPVVRHDYRIGVPDHIPLWREALNTDDGRYGGSGVLNPEPLKAEPTAWH
GRPASILPVLPPLATIWLGPA
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
gtgctcgccgcggcgccgctcggggacaccgaccgggagcggctgctctccggctcccat
cacgacccgcacgccctcctcggcgcccatcccgtgcgcggcggaatcctcttccgtgcg
ctgcgcccgtacgccaggtccgtggccgtcacggccactgggctgcgcgcacagctgcgc
cccgagggggacgggctgttctccggggtgctcccgctccgggggatccccgactaccgg
ctgctggtcgagtacgagaacgggcagtacgagaccgggcagaccgcgcagaccgcgcag
accccgcagcacgacccgtaccgcttcctccccgccctcggcgaactggatctgcacctg
atcggcgagggccgccacgaggagctgtggcgcgcgctgggcacgcatccgatgacgcac
cacggcgtggccgggacgcggttcacggtgtgggcgccggacgcccgaggcgtacgcgtg
gccggggacttcaactactgggacggtacggccgccccgatgcgctcactgggcggcagc
ggcgtatgggagctgttcctgcccggtgtgggtgacggcgcggtgtacaagttcgacatc
acccgcccggacgggagccacaccctgcgcgccgacccgatggcgcgccacaccgagtgt
ccgcccgccacggcctcgatcgtgcacacctcccaccacgagtggcgcgatgcggagtgg
ctggcccgccgggcggggcagtgcgtgcacgagtcgccgttctcggtgtacgaggtgcat
ctgccctcctggcgcccaggcctgacgtaccgccagctggccgagcagcttcccgcgtac
gtcaaggacctcggcttcacccatgtcgagctgatgccggtggccgagcaccccttcggc
ggctcgtggggctaccaggtcaccggcttctacgcgcccaccgcccgcctcggcaccccc
gacgacttcaagtatctggtcgacgccctgcaccgggcgggcatcggcgtgctggtcgac
tgggtgcccgcgcacttcccccgggatgagtgggcgctggccgagttcgacggcagaccg
ctgtacgaacccgccgacccggcccgggccgcgcatccggactggggcactctggagttc
gactacggccgcacggaggtgcgcaacttcctggtggcgaacgccgtgtactggtgtgag
gagttccatgtggacggcctgcgggtggacgccgtggcctccatgctctacctcgactac
tcccgcgagccgggccagtggacgcccaatgcccacggcggccgggagaacctggacgct
gtcgcgtttctgcaggagatgaacgcgaccgtctaccgccgctgccccggcgtgctgacc
atcgccgaggagtccaccgcctgggacggcgtcacccgtgccacccaccacgtgggcccc
agcggcttcggcggcctcggcttcgggctgaagtggaacatggggtggatgcacgattcg
ctgggctacgtcggccatgagccggtgcaccgcaagtaccaccaccatgagatgaccttc
tcgatggtgtacgcgtacagcgagaactatgtgctgcccatctcccatgacgaggtggtg
cacggaaagcggtccctggtgtcgaagatgcccggtgactggtggcagcggcgcgcagac
caccgtgcgtacctgggcttcatgtgggcgcacccgggcaagcaactccttttcatggga
caggagttcgcgcagggcgcggagtggtcggagagccacggcccggactggtggctgctc
gacccctcgtactccgccgagcccgaccaccgcggcgtacgcgacctggtccgcgagctg
aaccaggtgtacctggccacgcccgcgctgtggcagcgggacaccgtcccggaggggttc
gcctgggtcgagggcgacgcgcgcgaggacaacgtcttcgccttcctgcgcttcgccgcg
gacggctcaccgctgctggccatcagcaacttctcgcccgtcgtacgccatgactaccgc
atcggcgtcccggaccacatcccgctgtggcgcgaggcgctgaacaccgacgacggccgc
tacggcggcagcggcgtcctcaacccggaaccgctcaaggccgaacccaccgcctggcac
gggcggcccgcgagcatcctgccggtactgccgccgctggccacgatctggctggggccg
gcctga

DBGET integrated database retrieval system