KEGG   Streptomyces bingchenggensis: SBI_03731Help
Entry
SBI_03731         CDS       T01678                                 

Gene name
pfkA1
Definition
(GenBank) 6-phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00010  Glycolysis / Gluconeogenesis
sbh00030  Pentose phosphate pathway
sbh00051  Fructose and mannose metabolism
sbh00052  Galactose metabolism
sbh00680  Methane metabolism
sbh01100  Metabolic pathways
sbh01110  Biosynthesis of secondary metabolites
sbh01120  Microbial metabolism in diverse environments
sbh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBI_03731 (pfkA1)
   00030 Pentose phosphate pathway
    SBI_03731 (pfkA1)
   00051 Fructose and mannose metabolism
    SBI_03731 (pfkA1)
   00052 Galactose metabolism
    SBI_03731 (pfkA1)
  Energy metabolism
   00680 Methane metabolism
    SBI_03731 (pfkA1)
Enzymes [BR:sbh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     SBI_03731 (pfkA1)
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     SBI_03731 (pfkA1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase AIRC
Motif
Other DBs
NCBI-ProteinID: ADI06852
UniProt: D7CFU4
Position
complement(4809477..4810502)
Genome map
AA seq 341 aa AA seqDB search
MRIGVLTAGGDCPGLNAVIRSVVHRAVAGHGDEVIGFEDGFKGLLDGRHRKLDLDAVAGI
LARGGTILGSSRLERARLREACETSKDHARDYGIDVLIPIGGEGTLTAARMLSDAGLPIV
GVPKTIDNDISATDRTFGFDTAVGVATEAMDRLKTTAESHQRVMVVEVMGRHAGWIALES
GMAGGAHGICLPERPFEIDALVKMVEERFSRGKKFAVICVAEGAHPAEGTMDYKKGEIDQ
YGHERFTGIGNRLAAELERRLGKEARPVILGHVQRGGTPTAYDRVLATRFGWHAVEAAHR
GDFGMMTALRGTDIEMVPIAEAVTELKTVPVPRMDEAESVF
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatcggagttctcaccgcaggcggcgactgccccggcctgaacgctgtgatccgt
tcggtcgtccaccgtgccgtggccggccacggcgacgaggtcatcggcttcgaagacggc
ttcaaggggctgctcgacggccgccaccgcaaactcgacctggacgccgtggcgggcatc
ctcgcccgcggcggcaccatcctcggctcctcccgtctggagcgggcccggctgcgcgag
gcctgtgagacctccaaggaccacgcccgcgactacggcatcgacgtgctgatcccgatc
ggcggcgagggcaccctcaccgccgcccggatgctctccgacgccgggctgcccatcgtc
ggcgtacccaagaccatcgacaacgacatctccgccaccgaccgcaccttcggcttcgac
accgccgtcggcgtggccaccgaggccatggaccggctcaagaccaccgccgaatcccat
cagcgggtcatggtcgtcgaggtcatggggcgccacgcgggctggatcgcgctggagtcc
ggcatggcgggcggcgcgcacggcatctgcctgccggagcggccgttcgagatcgacgcg
ctggtgaagatggtggaggagcgcttctcccgcggcaagaagttcgcggtgatctgcgtc
gccgagggcgcgcaccccgccgagggcacgatggactacaagaagggcgagatcgaccag
tacggccacgagcggttcaccggtatcggcaaccgcctcgccgccgaactggagcgccgc
ctgggcaaggaggcccgtccggtcatcctcggccacgtccagcgcggcggcaccccgacc
gcgtacgaccgggtgctggccacccgcttcggctggcacgccgtcgaggccgcccaccgc
ggcgacttcggcatgatgaccgcgctgcgcggcacggacatcgagatggtgccgatcgcc
gaggcggtcaccgagctcaagacggttccggtgccccgcatggacgaggccgagtcggtc
ttctga

DBGET integrated database retrieval system