KEGG   Streptomyces bingchenggensis: SBI_03795Help
Entry
SBI_03795         CDS       T01678                                 

Gene name
thrC2
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SBI_03795 (thrC2)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SBI_03795 (thrC2)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SBI_03795 (thrC2)
Enzymes [BR:sbh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SBI_03795 (thrC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4876151..4877266)
Genome map
AA seq 371 aa AA seqDB search
MNTIADAGPAMSGTRRWQGWRGIIEEYRDRLPVSETTPVVTLREGGTPLVPAQVLSERTG
CEVHLKVEGANPTGSFKDRGMTMAISMAKEAGAQAVICASTGNTSASAAAYAVRAGMVCA
VLVPQGKIALGKMGQALVHGSKILQVDGNFDDCLELARGLSEKYPVALVNSVNPARIEGQ
KTASFEIVDMLGDAPDIHVLPVGNAGNITAYWKGYKEYATDGPLGAPASRTPRMWGFQAS
GAAPIVRGEPVRNPSTIATAIRIGNPASWAFAEQARDESGGLIDEVTDRQILAAYRLLAS
QEGVFVEPASAASVAGLLKAAEQGLVDPGQRIVCTVTGNGLKDPDWAVAGAPQPVTVPVD
ADTAAERLGLA
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaacacaatcgctgacgccgggcccgcgatgtccggcacccgccgctggcagggctgg
cggggcatcatcgaggagtaccgcgaccggctgccggtcagcgagacgacccccgtcgtc
accctgcgcgagggcggcaccccgctggtccccgcccaggtgctctccgagcgcaccggc
tgtgaggtgcacctcaaggtcgagggcgccaaccccaccgggtccttcaaggaccgcggc
atgaccatggccatcagcatggccaaggaggcgggcgcccaggccgtcatctgcgcctcc
accggcaacacctcggcctccgcggccgcctacgcggtacgggccggaatggtctgcgcc
gtcctcgttccgcagggcaagatcgcgctgggcaagatgggccaggccctggtccacggc
tccaagatcctccaggtcgacggaaacttcgacgactgcctggagctggcccgcgggctg
tccgagaagtacccggtggcgctggtcaattcggtcaacccggcccgtatcgaagggcag
aagaccgcgtcgttcgagatcgtcgacatgctcggcgacgcgcccgacatccatgtgctg
ccggtcggcaacgcgggcaacatcacggcctactggaagggctacaaggagtacgcgacg
gacggcccgctcggcgcgcccgcctcccgtacgccccggatgtgggggttccaggcctcc
ggcgcggcgcccatcgtgcgcggtgagccggtcaggaacccgagcaccatcgccaccgcc
atccgcatcggcaaccccgcctcctgggccttcgccgagcaggcgcgcgacgagtccggc
ggcctcatcgacgaggtgaccgaccgtcaaatcctcgccgcctaccggctgctcgcctcc
caggagggcgttttcgtcgagccggcctccgcggcgagcgtcgcgggtctgctcaaggcc
gccgagcagggtctggtcgaccccggccagcgcatcgtgtgcacggtgaccggaaacggc
ctcaaggacccggactgggcggtggcgggcgcgccgcagccggtcacggtgccggtggac
gcggacaccgccgccgagcggctcgggctggcttga

DBGET integrated database retrieval system