KEGG   Streptomyces bingchenggensis: SBI_04088Help
Entry
SBI_04088         CDS       T01678                                 

Gene name
folP1
Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    SBI_04088 (folP1)
Enzymes [BR:sbh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     SBI_04088 (folP1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
5194503..5195363
Genome map
AA seq 286 aa AA seqDB search
MLRLGRREFGENEQVIMAIVNRTPDSFYDRGATFQDGPALDRVEQAVAEGAAIVDIGGVK
AGPGEEVSAAEEVRRTVGFVAEVRRRHPDVVISVDTWRHEVGEAVCGAGADLLNDAWGGV
DPKLAEVAARYGAGLVCTHAGGAQPRTRPHRVAYDDVVADVLRVTLELARRAVELGVERE
SILIDPGHDFGKNTRHSLEATRRLGELAETGWPVLVSLSNKDFVGETLDRPVKERLLGTL
ATTAISAWLGARVYRVHEVAETRQVLDMVSSIAGHRPPAVARRGVA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgctacggctcggacggcgtgagttcggcgagaacgaacaagtgatcatggcgatcgtg
aaccggacgccggactccttctacgaccggggggccaccttccaggacgggcccgccctg
gaccgtgtcgagcaggcggtggcggagggcgccgccatcgtcgacatcggcggggtgaag
gccggtcccggcgaggaggtgagcgccgccgaggaggtgcggcgcacggtgggtttcgtg
gccgaggtgcgccggcgccacccggacgtggtgatcagcgtggacacctggcgccacgag
gtcggggaggcggtctgcggggcgggcgcggatctgctcaacgacgcatggggcggggtc
gaccccaagctggccgaggtcgcggcccggtacggcgccggtctggtgtgcacccacgcg
ggcggcgcccagccgcgcaccaggccgcaccgggtcgcgtacgacgatgtggtggccgac
gtcctgcgggtcacgctggagctcgcgcggcgcgctgtcgagctgggcgtggagcgtgag
tcgatcctgatcgacccgggccacgacttcggcaagaacacccggcactcgctggaggcg
acccggcggctcggcgagctggcggaaaccggctggcccgtgctggtctcgctgtccaac
aaggacttcgtgggcgagacgctggaccggccggtcaaggagcggctgctgggcaccctc
gcgacgaccgcgatctcggcctggctcggcgcccgggtctaccgggtgcacgaggtggcc
gagacccgccaggtgctggacatggtgtcctccatcgccggtcaccggcccccggcggtc
gcccggcgcggtgtggcctga

DBGET integrated database retrieval system