KEGG   Streptomyces bingchenggensis: SBI_04157Help
Entry
SBI_04157         CDS       T01678                                 

Gene name
ppgK
Definition
(GenBank) putative polyphosphate glucokinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00010  Glycolysis / Gluconeogenesis
sbh00520  Amino sugar and nucleotide sugar metabolism
sbh01100  Metabolic pathways
sbh01110  Biosynthesis of secondary metabolites
sbh01120  Microbial metabolism in diverse environments
sbh01130  Biosynthesis of antibiotics
sbh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBI_04157 (ppgK)
   00520 Amino sugar and nucleotide sugar metabolism
    SBI_04157 (ppgK)
Enzymes [BR:sbh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     SBI_04157 (ppgK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ADI07278
UniProt: D7BRU1
Position
complement(5270589..5271554)
Genome map
AA seq 321 aa AA seqDB search
MEPTHTASQQQAPQQAQQQAQSQSQPEAAVRPGDAVSVLGVDIGGSGIKGAPVDLARGDL
AVERFKVLTPQPSTPEAVAESVREVIDSFGWSGRPVGVTFPGVVTSGTTRTAANVDKSWI
DVDTAALLGERLGSPVTVVNDADAAGIAEMTFGAGRGRTGTVILLTFGTGIGSAVFIDGR
LVPNTELGHLELAGHEAEKRASTKAKDDHNLSWHSWAHRVQRYLEHVEMLFSPELFVIGG
GVSRKASKFLPLIEGIKAEIVPAQLLNNAGIVGAAMAARTAMAAQAETAGQAATAGRPEA
ADRAATRDSAAAPTAGAGSAD
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggaaccgacgcacaccgcatcgcagcaacaggcgccgcagcaggcgcagcagcaagcg
cagtcgcagtcgcagcctgaggccgccgtccgtcccggcgacgccgtcagcgtcctgggc
gtggacatcggcggctcgggcatcaagggcgcgccggtggacctggcgcgcggggacctg
gccgtggagcgcttcaaggtcctcaccccgcagccgtccacgcccgaagcggtggcggag
agcgtacgggaggtcatcgactccttcggctggtccgggcggccggtcggggtgaccttc
ccgggcgtggtgaccagcggtacgacgcgcaccgccgccaacgtcgacaagagctggatc
gatgtcgacacggcggcgctgctcggcgagcgcctggggtcgccggtcacggtggtcaac
gacgccgatgcggccggtatcgcggagatgaccttcggcgccgggcgcggccgtacgggc
acggtcatcctgctcaccttcgggaccggcatcggcagcgccgtcttcatcgacgggcgc
ctggtgcccaacaccgaactgggccatctggagctggccggtcacgaggcggagaagcgt
gcctcgaccaaggccaaggacgaccacaacctgagctggcacagctgggcgcaccgggtg
cagcggtatctcgagcacgtggagatgctgttctcgcccgagctgttcgtgatcggcggc
ggggtgagccgtaaggcgtcgaagttcctgccactgatcgaggggatcaaggccgagatc
gtgcctgcgcagctgttgaataacgcggggatcgtgggggccgcgatggctgcccggacc
gcgatggctgcccaggccgagacggctggtcaggccgcgacggctggtcggcccgaggcg
gctgatcgggccgcgacccgcgactctgctgctgctcccactgctggcgctggttccgcc
gactga

DBGET integrated database retrieval system