KEGG   Streptomyces bingchenggensis: SBI_04328Help
Entry
SBI_04328         CDS       T01678                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SBI_04328
   01230 Biosynthesis of amino acids
    SBI_04328
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBI_04328
   00051 Fructose and mannose metabolism
    SBI_04328
   00562 Inositol phosphate metabolism
    SBI_04328
Enzymes [BR:sbh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SBI_04328
Exosome [BR:sbh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SBI_04328
  Exosomal proteins of bladder cancer cells
   SBI_04328
  Exosomal proteins of melanoma cells
   SBI_04328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(5444778..5445575)
Genome map
AA seq 265 aa AA seqDB search
MPRPASVTIGVSLKMYFGHHETLNWCRRIADIADRHPAVTGGLAEVFVLPSFPTLVPAAG
LLAGTGVRVGAQDLCAQDTGAYTGEVSGAQLKEIGCGYAEVGHAERRRLFHEDEAVVAAK
TAAALRGGLTPVLCVGEPERTDAAQAAARCVAEVESALADAERAGTLGPLVVAYEPQWAI
GAPEPASPEHIRAVCAALAAWLAGRGPLAGSRVVYGGSAGPGLLTRLGPEVGGLFLGRFA
HDPAAFEQILDEAMALHGTPVAGGV
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgccccgacccgcttccgtcaccatcggcgtgagcctcaagatgtacttcggccaccac
gaaacgctcaactggtgccgccgcatcgcggacatcgccgaccgccacccggccgtcacc
ggcggcctggccgaggtcttcgtcctcccctccttccccaccctcgtcccggccgccggc
ctgctggccggcaccggggtgcgggtcggcgcccaggacctgtgcgcccaggacaccggg
gcgtacaccggcgaggtcagcggcgcccagctcaaggagatcggctgcggctacgccgag
gtggggcacgccgagcgacgccgcctcttccacgaggacgaggcggtcgtggccgcgaag
accgccgccgcgctgcgaggcggcctcacgcccgtcctgtgcgtcggcgaacccgagcgc
accgacgcggcgcaggccgcagcccgctgcgtcgccgaggtcgagtccgccctcgcggac
gccgagcgggccgggacgctcggcccgctggtcgtggcgtacgaaccccagtgggccatc
ggcgcgcccgaaccggcctcgcccgagcacatccgcgcggtgtgcgccgcgctggccgcg
tggctcgccgggcgggggccgctggccggcagccgggtcgtgtacggcggcagcgcgggg
cccggtctgctcacccggctcggccccgaggtcggcgggctcttcctgggccgcttcgcc
cacgacccggcggcgttcgaacagatcctggatgaggcgatggccctgcacgggacgcct
gtcgcggggggtgtgtga

DBGET integrated database retrieval system