KEGG   Streptomyces bingchenggensis: SBI_04328Help
Entry
SBI_04328         CDS       T01678                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00010  Glycolysis / Gluconeogenesis
sbh00051  Fructose and mannose metabolism
sbh00562  Inositol phosphate metabolism
sbh01100  Metabolic pathways
sbh01110  Biosynthesis of secondary metabolites
sbh01120  Microbial metabolism in diverse environments
sbh01130  Biosynthesis of antibiotics
sbh01200  Carbon metabolism
sbh01230  Biosynthesis of amino acids
Module
sbh_M00002  Glycolysis, core module involving three-carbon compounds
sbh_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBI_04328
   00051 Fructose and mannose metabolism
    SBI_04328
   00562 Inositol phosphate metabolism
    SBI_04328
Enzymes [BR:sbh01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     SBI_04328
Exosome [BR:sbh04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   SBI_04328
  Exosomal proteins of bladder cancer cells
   SBI_04328
  Exosomal proteins of melanoma cells
   SBI_04328
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ADI07448
UniProt: D7BTK9
Position
complement(5444778..5445575)
Genome map
AA seq 265 aa AA seqDB search
MPRPASVTIGVSLKMYFGHHETLNWCRRIADIADRHPAVTGGLAEVFVLPSFPTLVPAAG
LLAGTGVRVGAQDLCAQDTGAYTGEVSGAQLKEIGCGYAEVGHAERRRLFHEDEAVVAAK
TAAALRGGLTPVLCVGEPERTDAAQAAARCVAEVESALADAERAGTLGPLVVAYEPQWAI
GAPEPASPEHIRAVCAALAAWLAGRGPLAGSRVVYGGSAGPGLLTRLGPEVGGLFLGRFA
HDPAAFEQILDEAMALHGTPVAGGV
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgccccgacccgcttccgtcaccatcggcgtgagcctcaagatgtacttcggccaccac
gaaacgctcaactggtgccgccgcatcgcggacatcgccgaccgccacccggccgtcacc
ggcggcctggccgaggtcttcgtcctcccctccttccccaccctcgtcccggccgccggc
ctgctggccggcaccggggtgcgggtcggcgcccaggacctgtgcgcccaggacaccggg
gcgtacaccggcgaggtcagcggcgcccagctcaaggagatcggctgcggctacgccgag
gtggggcacgccgagcgacgccgcctcttccacgaggacgaggcggtcgtggccgcgaag
accgccgccgcgctgcgaggcggcctcacgcccgtcctgtgcgtcggcgaacccgagcgc
accgacgcggcgcaggccgcagcccgctgcgtcgccgaggtcgagtccgccctcgcggac
gccgagcgggccgggacgctcggcccgctggtcgtggcgtacgaaccccagtgggccatc
ggcgcgcccgaaccggcctcgcccgagcacatccgcgcggtgtgcgccgcgctggccgcg
tggctcgccgggcgggggccgctggccggcagccgggtcgtgtacggcggcagcgcgggg
cccggtctgctcacccggctcggccccgaggtcggcgggctcttcctgggccgcttcgcc
cacgacccggcggcgttcgaacagatcctggatgaggcgatggccctgcacgggacgcct
gtcgcggggggtgtgtga

DBGET integrated database retrieval system