KEGG   Streptomyces bingchenggensis: SBI_04652Help
Entry
SBI_04652         CDS       T01678                                 

Gene name
deoA
Definition
(GenBank) thymidine phosphorylase
  KO
K00758  thymidine phosphorylase [EC:2.4.2.4]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00240  Pyrimidine metabolism
sbh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SBI_04652 (deoA)
Enzymes [BR:sbh01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     SBI_04652 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycos_transf_3 PYNP_C Glycos_trans_3N Biotin_lipoyl TMP_2
Motif
Other DBs
NCBI-ProteinID: ADI07772
UniProt: D7BZ36
Position
complement(5801253..5802533)
Genome map
AA seq 426 aa AA seqDB search
MDAITVIRAKRDGGRLTDAQIDWIIDAYTRGEVAHEQMSALAMAIYLNGMDRAEIARWTA
AMIASGERMDFSSLARPTADKHSTGGVGDKITLPLAPLVAACGAAVPQLSGRGLGHTGGT
LDKLESIPGWRARLSGEEMLRVLEDVGSVICAAGEGLAPADRKLYALRDVTGTVESIPLI
ASSIMSKKIAEGTGSLVLDVKVGSGAFMKDLASARELAATMVGLGTDHGVRTVALLTGMA
TPLGRTAGNALEVRESVEVLAGGGPADVVELTLALAREMLDAAGLPDADPAKALADGSAM
DHWRRMIAAQGGDPDAPLPVAREQHVVTAESTGVLTGLDAYAVGVVAWRLGAGRARKEDP
VQAGAGVEIHAKPGDAVRAGDPLLTLHTDTPEKFDYALEALAGAVSYAPPGTEFTPEPIV
LDRIAR
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atggacgccatcaccgtcatccgcgccaaacgcgacggcggccgtctcaccgacgcccag
atcgactggatcatcgacgcctatacgcgcggtgaggtcgcccacgagcagatgtccgcg
ctcgcgatggcgatctacctcaacggcatggaccgtgcggagatcgcccgctggaccgcc
gcgatgatcgcgtccggcgagcgcatggacttctcgtccctagcgcgcccgaccgccgac
aagcactcgaccggcggcgtgggcgacaagatcacgctgccgctggccccgctggtggcc
gcctgcggcgcggccgtaccgcagctgtccgggcgcggtctcggccacaccggcggcacg
ctcgacaagctggagtccatcccgggctggcgggcgcggctctccggcgaggagatgctg
cgggtgctcgaagacgtcggctccgtcatctgcgcggcaggcgaggggctggcgcccgcg
gaccgcaagctgtacgcgctgcgcgatgtgaccgggaccgtggagtcgatcccgctcatc
gcgagcagcatcatgtcgaagaagatcgccgagggtacgggctcgctggtgctggacgtg
aaggtcggctccggcgcctttatgaaggacctggcctcggcgcgggagctggccgccacc
atggtgggcctgggcaccgaccacggggtccgtacggtcgccctgctcaccggcatggcc
accccgctcggccgcaccgccggcaacgccctcgaggtccgcgagtccgtggaggtcctg
gcgggcggcggcccggccgacgtcgtcgagctcaccctcgccctcgcccgcgagatgctg
gacgcggcgggcctgccggacgccgatccggccaaggccctcgccgacggctccgcgatg
gaccactggcgccgcatgatcgccgcccagggcggcgacccggacgcgccgctgcccgta
gcccgcgaacagcacgtcgtgactgccgagtcgaccggggtgctgaccggcttggacgca
tacgcggtcggcgtcgtcgcctggcgtcttggcgcgggccgggcccgtaaggaggacccg
gtgcaggcgggggcgggcgtggagatccacgccaagccgggggatgcggtacgggcgggc
gatccgctgctgacgctgcacacggacacgcctgagaagttcgactacgcgcttgaggcg
ctggcgggggcggtgagctacgccccgccggggacggagttcacgcccgagccgatcgtt
ctggaccgcatcgcgcggtaa

DBGET integrated database retrieval system