KEGG   Streptomyces bingchenggensis: SBI_04801Help
Entry
SBI_04801         CDS       T01678                                 

Gene name
choD
Definition
(GenBank) putative cholesterol oxidase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00984  Steroid degradation
sbh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    SBI_04801 (choD)
Enzymes [BR:sbh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     SBI_04801 (choD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_C GMC_oxred_N DAO FAD_binding_2 Pyr_redox_2 NAD_binding_8 FAD_binding_3 Fer4_9 Fer4_10 Fer4_8 HI0933_like Pyr_redox GIDA Fer4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: ADI07921
UniProt: D7C120
Position
complement(5967960..5969777)
Genome map
AA seq 605 aa AA seqDB search
MNDAYDAADHDAYDDAYDYDVIVVGSGFGGSVTALRLTEKGYRVGVLEAGRRFTPETLPK
NSWHLRDYLWAPALGCYGIQRIHVLGKVMVLAGAGVGGGSLNYANTLYVPPEPFFQDPQW
GAITDWRAELAPYYDQARRMLGARLNKTMTPSDEHLKAAAERMGVGESFHMAPVGVFFGD
GDDADGTTTAAPGERVPDPYFGGAGPSRRACTECGECMTGCRHGAKNTLNENYLHLAERA
GAVVHPMTTVVAISEDRRGGYRVTTVPTDRRRKGPPRALRAHQVVLAAGTYGTQTLLHTM
RDKGLLPRISDRLGMLTRTNSEALVGAQTSDRRYRKAHPGRARADFTRGVAITSSIHPDD
TTHIEPVRYGKGSNAMGLLSVLQIPDGGRLPRWLRFLGANLRHPTLAMRSMSNRRWSERT
IIGLVMQTHDNSLTTYRKPKGLGKGLLTARQGHGEPNPDHIPEGAEAARHLAESINGFAG
SNVGELMGTPPTAHFLGGCPIGTDPDHGVIDPYHRLYGHPGIHVVDGAAVSANLGVNPSL
TITAQAERAMSLWPNKGTPDPRPPQGAPYKRLSPVAPTTPTVPEDAFGALKLPLLPVPKV
PPAAD
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
gtgaacgatgcgtacgacgctgcggaccacgacgcgtacgacgacgcgtacgactacgac
gtgatcgtcgtcggctcgggcttcggcggctcggtgacagccctgcgcctgaccgagaag
gggtatcgcgtcggggtcctggaggcgggccgccgcttcacccccgagaccctgcccaag
aactcctggcacctccgcgactacctgtgggcccccgccctcggctgctacggcatccag
cgcatccacgtcctgggcaaggtcatggtgctggcgggcgccggggtcgggggcggctcg
ctcaactacgccaacaccctctacgtaccgcccgagcccttcttccaggatccgcagtgg
ggcgccatcaccgactggcgggcggagctcgccccgtactacgaccaggcgcggcggatg
ctcggggcgcgcctgaacaagaccatgaccccctccgacgagcatctgaaggccgccgcc
gagcggatgggggtgggcgagagcttccatatggcgccggtgggggtcttcttcggggac
ggcgacgacgcggacggcacgaccacggcggccccgggggagcgcgtccccgacccgtac
ttcggcggcgcgggcccctcccgccgggcctgtaccgaatgcggcgagtgcatgaccggc
tgccgccacggcgcgaagaacaccctcaacgagaactacctccacctcgccgagcgggcc
ggcgccgtcgtccaccccatgaccaccgtcgtggccatcagcgaggaccggcgcggcggc
taccgggtcaccaccgtccccaccgaccgccgccgcaagggcccgccgcgcgcgctgcgc
gcccaccaggtcgtgctggccgccgggacgtacggcacccagacgctgctgcacaccatg
cgggacaagggcctgctgccccggatctccgaccggctcggcatgctcacccgcaccaac
tccgaggccctggtcggcgcacagacctcggaccgtcgctaccgcaaggcccacccgggg
cgggcgcgggccgacttcacccgtggcgtggcgatcacctcctccatccaccccgacgac
accacccacatcgaacccgtccgctacggcaagggctccaacgcgatggggctgctgtcc
gtcctccagatccccgacggcggccgactgccgcgctggctgcggttcctgggggccaac
ctccggcacccgaccctcgcgatgcgctcgatgtccaaccgccgctggtcggagcgcacc
atcatcggcctggtcatgcagacccacgacaactcgctcaccacctaccgcaagccgaag
ggcctcggaaagggcctgctcaccgcccggcagggccacggcgaacccaaccccgaccac
attcccgagggcgccgaggccgcccgccacctcgccgagtccatcaacggcttcgcgggc
agcaacgtcggcgaactgatgggcaccccgcccaccgcccacttcctcggcggctgcccg
atcggcacggaccccgaccacggcgtgatcgacccgtaccaccggttgtacgggcacccg
ggcatccacgtcgtggacggcgcggcggtctccgcgaacctgggtgtcaacccgtccctg
accatcacggcccaggcggagcgcgccatgtccctctggcccaacaagggcacccccgac
ccgcgcccgcctcaaggcgccccgtacaagcgcctgtccccggtcgcgcctacgaccccc
accgtccccgaggacgccttcggcgccctcaagctccccctgctcccggtcccgaaggtg
ccgcccgccgccgactag

DBGET integrated database retrieval system