KEGG   Streptomyces bingchenggensis: SBI_04870Help
Entry
SBI_04870         CDS       T01678                                 

Gene name
echA10
Definition
enoyl-CoA hydratase
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SBI_04870 (echA10)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    SBI_04870 (echA10)
   00650 Butanoate metabolism
    SBI_04870 (echA10)
  Lipid metabolism
   00071 Fatty acid degradation
    SBI_04870 (echA10)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SBI_04870 (echA10)
   00310 Lysine degradation
    SBI_04870 (echA10)
   00360 Phenylalanine metabolism
    SBI_04870 (echA10)
   00380 Tryptophan metabolism
    SBI_04870 (echA10)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SBI_04870 (echA10)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SBI_04870 (echA10)
   00281 Geraniol degradation
    SBI_04870 (echA10)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    SBI_04870 (echA10)
   00627 Aminobenzoate degradation
    SBI_04870 (echA10)
   00930 Caprolactam degradation
    SBI_04870 (echA10)
Enzymes [BR:sbh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SBI_04870 (echA10)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6047208..6048065)
Genome map
AA seq 285 aa AA seqDB search
MTDAPPPLVRHAYARGITTLTLDSPHNRNALSTRLVAELSEALAAAGRDAGTRAVLLTHT
GTTFCAGADLSEPPTRSAALNLVALLRSIVELPKPVVARVTGHVRAGGLGLLGACDIAAA
GGGASFAFTEARLGLAPAMISIPLLPRLDPRAAARYYLTGERFDAAEAMRIGLVTLGTPA
GDRTVDPAADPTAGPAGDVDELLAPVLDGLRRGSPQGLAESKRLVTAEVLAAFARETDRL
AERSAALFASAEAREGMTAFLERRDPAWVSDVLGEGSAPGGGEAR
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgacggacgcgccaccacctctcgtacggcacgcgtacgcgcgcggcatcaccacgctg
accctcgactcaccgcacaaccgcaacgcgctctccacgcggctggtcgccgagctgagc
gaggcgctggcggcggccgggcgggacgcgggcacgcgggcggtgctgctgacccacacc
ggcaccacgttctgcgcgggcgcggatctgagcgagccgcccacgcggtcggcggcgctg
aacctagtcgcgctgttgcggtcgatcgtggagctgccgaagccggtggtggcccgggtg
accggacatgtccgggcgggcggtctggggctgctgggcgcatgcgatatcgcggcggcg
ggcgggggcgcgagcttcgccttcaccgaggcccggctggggctcgcacccgcgatgatc
tccataccgctgctgccccggctggacccgcgcgcggcggcccgctactacctgacgggc
gagcggttcgacgcggccgaggcgatgcggatcggcctggtgaccctggggactccggcg
ggagaccggacagtagacccggcagcagacccgacagcaggcccggcgggagatgtcgac
gaactgctggcgccggtcctcgacgggctgcggcgcggctccccgcaggggctcgccgag
tccaagcggctggtcacggcggaggtgctggcggccttcgcccgggagacggaccggctg
gcggagcggtccgcggcgctgttcgcctcggccgaggcccgcgagggcatgacggccttc
ctggagcgacgggacccggcgtgggtgtcggacgtgctgggagagggttcggcccccggc
ggcggggaggcgcggtga

DBGET integrated database retrieval system