KEGG   Streptomyces bingchenggensis: SBI_04949Help
Entry
SBI_04949         CDS       T01678                                 

Gene name
thrC3
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SBI_04949 (thrC3)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SBI_04949 (thrC3)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    SBI_04949 (thrC3)
Enzymes [BR:sbh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     SBI_04949 (thrC3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(6128651..6129964)
Genome map
AA seq 437 aa AA seqDB search
MAVQAVESSTASEGSTGSAGSSVSLGPAVALSCRECGERFPLGPIFACAECFGPLEVAYD
LPTGDPEGLRKRIEAGPNNIWRYAPLLPVPADVADKPNINPGFTKLVKADNLARELGVTG
ELYIKDDSGNPTHSFKDRVVAQAVEAARAFGFTTLSCSSTGNLAGAVGAAAARAGLRSCT
FIPHDLEQGKVVMAAIYGGDLVAIEGTYDDVNRFCSELIGDPAGEGWGFVNVNLRPYYAE
GSKTLAYEICEQLGWRLPDQLVIPIASGSQLTKIDKGLKELIALGLVEDKPYKIFGAQAE
GCSPVSTAFKAGHDVVRPQKPNTIAKSLAIGNPADGPYVLDIARRTGGAVEDVNDEQVVD
AIKLLARTEGIFAETAGGVTLGVAKKLLENGVLDPALTTVVLNTGDGLKTLDAVAPTTGP
TVVIRPSLDAFREAGLG
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgcaagctgtcgaaagctctaccgcttctgagggttccactggttccgccggt
tcctccgtctcgctcggccccgccgtcgccctgtcctgtcgcgagtgcggggagcgtttc
cccctcggccccattttcgcctgtgcggagtgtttcggaccgctcgaagtcgcgtacgac
ctgccgaccggcgaccctgaggggctgcgcaagcggatcgaggccgggccgaacaacatc
tggcgttacgccccgctgctgcccgtcccggcggacgtggccgacaagccgaacatcaac
cccggcttcaccaagctggtgaaggccgacaacctggcccgcgagctgggggtgaccggc
gagctgtacatcaaggacgactccgggaacccgacgcactccttcaaggaccgcgtggtc
gcccaggccgtcgaggccgcccgcgccttcggcttcaccaccctctcctgctcctccacc
ggcaacctcgcgggcgcggtcggcgccgcggccgcccgcgcgggcctgcgctcctgcacc
ttcatcccgcacgacctggagcagggcaaggtcgtcatggccgccatctacggcggcgac
ctggtcgccatcgagggcacgtacgacgacgtcaaccgcttctgcagcgagctgatcggc
gacccggcgggcgagggctggggctttgtcaacgtcaacctccgcccgtactacgcggag
gggtccaagaccctcgcgtacgagatctgcgaacagctcggctggcggctgccggaccag
ctggtcatcccgatcgcgtccggctcgcagctcacaaagatcgacaaggggctgaaggag
ctcatcgcgctcggcctggtcgaggacaagccgtacaagatcttcggcgcccaggccgag
ggctgctccccggtctccaccgccttcaaggccggccatgacgtggtgcggccgcagaag
ccgaacaccatcgccaagtcgctggccatcggcaacccggcggacgggccgtatgtgctg
gacatcgcgcgccgtacgggcggggcggtggaggacgtgaacgacgagcaggtcgtcgac
gcgatcaagctgctggcccgtacggaggggatcttcgcggagaccgcgggcggggtgacc
ctgggcgtggcgaagaagctgctcgagaacggggtgctggaccccgccctcaccaccgtc
gtgctcaataccggagacggcctcaagacgcttgacgcggtcgccccgacgactgggccc
acggtggtgatccgcccgagtctcgacgcgttccgcgaggctggtctgggctga

DBGET integrated database retrieval system