KEGG   Streptomyces bingchenggensis: SBI_04955Help
Entry
SBI_04955         CDS       T01678                                 

Definition
(GenBank) sugar kinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
sbh  Streptomyces bingchenggensis
Pathway
sbh00010  Glycolysis / Gluconeogenesis
sbh00052  Galactose metabolism
sbh00500  Starch and sucrose metabolism
sbh00520  Amino sugar and nucleotide sugar metabolism
sbh00521  Streptomycin biosynthesis
sbh01100  Metabolic pathways
sbh01110  Biosynthesis of secondary metabolites
sbh01120  Microbial metabolism in diverse environments
sbh01130  Biosynthesis of antibiotics
sbh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBI_04955
   00052 Galactose metabolism
    SBI_04955
   00500 Starch and sucrose metabolism
    SBI_04955
   00520 Amino sugar and nucleotide sugar metabolism
    SBI_04955
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SBI_04955
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    SBI_04955
Enzymes [BR:sbh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SBI_04955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: ADI08075
UniProt: D7C313
Position
6135606..6136544
Genome map
AA seq 312 aa AA seqDB search
MKHVIALDVGGTGMKAALVGADGALLHEDRRPTGRERGPEAVVATILDFAAELRAIGEQR
YGTPAAAAGVGVPGVLDEDRGIAVFAANLGWRDVPLRALLAERLGGTPVALAHDVRMGGL
AEGRIGAGEGADRFLFVSVGTGIAGAIGIHGRVDPGANGSSGEIGHIVVRPGGPACGCGQ
FGCLETLASASAVGRAWARASGDDPMKVDAADCAKAVESGDPRAVAVWQEAVGALADGLV
TGVTLLDPGVLIVGGGLAEAGETLFAPLRTAVEERITFQKLPSIVPAALGDTAGCLGAGL
LAWDLLSMEVSA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacacgtcatcgccctcgatgtgggcggcaccggcatgaaggccgccctcgtgggg
gcggacggcgcgctcctccatgaggacagacggcccacgggccgcgagcgcggaccggaa
gccgtcgtcgccacgatcctcgacttcgccgccgagctgcgcgccatcggtgagcagcgc
tacggcacccccgccgccgcggccggggtcggcgtgcccggggtcctcgacgaggaccgc
ggcatcgccgtcttcgccgccaacctcggctggcgcgatgtgccgctgcgcgccctgctg
gccgaacggctcggcgggacgccggtcgcgctggcccacgacgtacgcatgggcgggctg
gccgagggacggataggagccggcgaaggggccgaccgcttcctgttcgtatcggtgggc
accggcatcgccggtgccatcggcatccacggacgcgtcgaccccggggccaacggctcc
tcgggcgagatcggccacatcgtcgtacggccgggcggcccggcgtgcggctgcgggcag
ttcggctgtctggagacgctcgcctccgcctccgcggtgggccgcgcctgggcgcgggcg
agcggtgatgaccccatgaaggtcgacgccgcggactgcgccaaggccgtcgagtccggc
gatccgcgggcggtggcggtgtggcaggaggccgtgggcgcgctcgccgacggcctggtc
accggggtcaccctgctggaccccggggtgctgatcgtcggcgggggtctggccgaggcc
ggggagaccctgttcgcgccgctgcgcacggcggtcgaggagcggatcacgttccagaag
ctgccctctatcgtcccggcggccctcggggacaccgccggatgcctgggcgcgggcctg
ctcgcctgggatctactctccatggaggtaagcgcctga

DBGET integrated database retrieval system