KEGG   Streptomyces bingchenggensis: SBI_04955Help
Entry
SBI_04955         CDS       T01678                                 

Definition
sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:sbh01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:sbh00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:sbh00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:sbh00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sbh00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:sbh00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6135606..6136544
Genome map
AA seq 312 aa AA seqDB search
MKHVIALDVGGTGMKAALVGADGALLHEDRRPTGRERGPEAVVATILDFAAELRAIGEQR
YGTPAAAAGVGVPGVLDEDRGIAVFAANLGWRDVPLRALLAERLGGTPVALAHDVRMGGL
AEGRIGAGEGADRFLFVSVGTGIAGAIGIHGRVDPGANGSSGEIGHIVVRPGGPACGCGQ
FGCLETLASASAVGRAWARASGDDPMKVDAADCAKAVESGDPRAVAVWQEAVGALADGLV
TGVTLLDPGVLIVGGGLAEAGETLFAPLRTAVEERITFQKLPSIVPAALGDTAGCLGAGL
LAWDLLSMEVSA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacacgtcatcgccctcgatgtgggcggcaccggcatgaaggccgccctcgtgggg
gcggacggcgcgctcctccatgaggacagacggcccacgggccgcgagcgcggaccggaa
gccgtcgtcgccacgatcctcgacttcgccgccgagctgcgcgccatcggtgagcagcgc
tacggcacccccgccgccgcggccggggtcggcgtgcccggggtcctcgacgaggaccgc
ggcatcgccgtcttcgccgccaacctcggctggcgcgatgtgccgctgcgcgccctgctg
gccgaacggctcggcgggacgccggtcgcgctggcccacgacgtacgcatgggcgggctg
gccgagggacggataggagccggcgaaggggccgaccgcttcctgttcgtatcggtgggc
accggcatcgccggtgccatcggcatccacggacgcgtcgaccccggggccaacggctcc
tcgggcgagatcggccacatcgtcgtacggccgggcggcccggcgtgcggctgcgggcag
ttcggctgtctggagacgctcgcctccgcctccgcggtgggccgcgcctgggcgcgggcg
agcggtgatgaccccatgaaggtcgacgccgcggactgcgccaaggccgtcgagtccggc
gatccgcgggcggtggcggtgtggcaggaggccgtgggcgcgctcgccgacggcctggtc
accggggtcaccctgctggaccccggggtgctgatcgtcggcgggggtctggccgaggcc
ggggagaccctgttcgcgccgctgcgcacggcggtcgaggagcggatcacgttccagaag
ctgccctctatcgtcccggcggccctcggggacaccgccggatgcctgggcgcgggcctg
ctcgcctgggatctactctccatggaggtaagcgcctga

DBGET integrated database retrieval system