KEGG   Streptomyces bingchenggensis: SBI_04955Help
Entry
SBI_04955         CDS       T01678                                 

Definition
sugar kinase
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
sbh  Streptomyces bingchenggensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:sbh00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SBI_04955
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SBI_04955
   00052 Galactose metabolism
    SBI_04955
   00500 Starch and sucrose metabolism
    SBI_04955
   00520 Amino sugar and nucleotide sugar metabolism
    SBI_04955
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    SBI_04955
   00524 Butirosin and neomycin biosynthesis
    SBI_04955
Enzymes [BR:sbh01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     SBI_04955
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
6135606..6136544
Genome map
AA seq 312 aa AA seqDB search
MKHVIALDVGGTGMKAALVGADGALLHEDRRPTGRERGPEAVVATILDFAAELRAIGEQR
YGTPAAAAGVGVPGVLDEDRGIAVFAANLGWRDVPLRALLAERLGGTPVALAHDVRMGGL
AEGRIGAGEGADRFLFVSVGTGIAGAIGIHGRVDPGANGSSGEIGHIVVRPGGPACGCGQ
FGCLETLASASAVGRAWARASGDDPMKVDAADCAKAVESGDPRAVAVWQEAVGALADGLV
TGVTLLDPGVLIVGGGLAEAGETLFAPLRTAVEERITFQKLPSIVPAALGDTAGCLGAGL
LAWDLLSMEVSA
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacacgtcatcgccctcgatgtgggcggcaccggcatgaaggccgccctcgtgggg
gcggacggcgcgctcctccatgaggacagacggcccacgggccgcgagcgcggaccggaa
gccgtcgtcgccacgatcctcgacttcgccgccgagctgcgcgccatcggtgagcagcgc
tacggcacccccgccgccgcggccggggtcggcgtgcccggggtcctcgacgaggaccgc
ggcatcgccgtcttcgccgccaacctcggctggcgcgatgtgccgctgcgcgccctgctg
gccgaacggctcggcgggacgccggtcgcgctggcccacgacgtacgcatgggcgggctg
gccgagggacggataggagccggcgaaggggccgaccgcttcctgttcgtatcggtgggc
accggcatcgccggtgccatcggcatccacggacgcgtcgaccccggggccaacggctcc
tcgggcgagatcggccacatcgtcgtacggccgggcggcccggcgtgcggctgcgggcag
ttcggctgtctggagacgctcgcctccgcctccgcggtgggccgcgcctgggcgcgggcg
agcggtgatgaccccatgaaggtcgacgccgcggactgcgccaaggccgtcgagtccggc
gatccgcgggcggtggcggtgtggcaggaggccgtgggcgcgctcgccgacggcctggtc
accggggtcaccctgctggaccccggggtgctgatcgtcggcgggggtctggccgaggcc
ggggagaccctgttcgcgccgctgcgcacggcggtcgaggagcggatcacgttccagaag
ctgccctctatcgtcccggcggccctcggggacaccgccggatgcctgggcgcgggcctg
ctcgcctgggatctactctccatggaggtaagcgcctga

DBGET integrated database retrieval system